(data stored in ACNUC1104 zone)

EMBL: CP000959.PE225

CP000959.PE225       Location/Qualifiers
FT   CDS             complement(273274..274281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3413"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   bur:Bcep18194_B1934 transglutaminase-like enzyme putative
FT                   cysteine protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92566"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Y7"
FT                   /protein_id="ACA92566.1"
FT                   /translation="MRLAIRHISRYQFDDQASHALQRLRLRPQSGPGQTVRAWQVTIDG
FT                   VEPALSYADGLGNRIDLVRHDRGAKAEIVVVAAGVVETQDRAGIIGNPEGYAPPWIFER
FT                   ETALTKAGETVRELAQALPIEPHGLDALHWLMTEVHGRIAYAPNVAADAAVDAETALQS
FT                   GEGTSRDHAHAFIAAARVLKIPARYISGYVLADSAMQRIADAKQNAGDVEEEEALALQS
FT                   GDGMQQVLGASHAAQSQSQSQGQSQSQGQSPAALGAQPQATALSQQPAGHAWAEAYVEG
FT                   LGWVGFDPFMNRCPDERYVRIAVGLDHRDAQPVTGLGATAVGVEISVVQTPELV"
     MRLAIRHISR YQFDDQASHA LQRLRLRPQS GPGQTVRAWQ VTIDGVEPAL SYADGLGNRI        60
     DLVRHDRGAK AEIVVVAAGV VETQDRAGII GNPEGYAPPW IFERETALTK AGETVRELAQ       120
     ALPIEPHGLD ALHWLMTEVH GRIAYAPNVA ADAAVDAETA LQSGEGTSRD HAHAFIAAAR       180
     VLKIPARYIS GYVLADSAMQ RIADAKQNAG DVEEEEALAL QSGDGMQQVL GASHAAQSQS       240
     QSQGQSQSQG QSPAALGAQP QATALSQQPA GHAWAEAYVE GLGWVGFDPF MNRCPDERYV       300
     RIAVGLDHRD AQPVTGLGAT AVGVEISVVQ TPELV                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page