(data stored in ACNUC1104 zone)

EMBL: CP000959.PE228

CP000959.PE228       Location/Qualifiers
FT   CDS             277299..278294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3416"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B1937
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92569"
FT                   /db_xref="GOA:B1K1Z0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Z0"
FT                   /protein_id="ACA92569.1"
FT                   /translation="MEAKWLEDFLSLADTKSFSRAARHRHLTQSAFSRRIAALETWMDA
FT                   KLVDRSINPVALTPAGQMFRGLAADILRSMYAARNLVNGYDQFAASDQVVRFAVAHTLV
FT                   FTLFPEWLKQLNSEVGHVTARVNAVNVPEGVQQLVEGECDLLLGYHHPQLPIVLDPNHF
FT                   PFVSLGVERILPVSSPDARGKPVFQLPGTPDAPLPLLAYSSGAFLGNIVEMLLLNATEP
FT                   YVLHRCFETHMSEALKGMVVAGHGIGWLPESCVAKELADGTLVCAGTGDWITELEIRLY
FT                   RSARKRGLAAEQLWAYIMNRPRAAIDGAIGTEEAAAPAMRSARRSAGGSR"
     MEAKWLEDFL SLADTKSFSR AARHRHLTQS AFSRRIAALE TWMDAKLVDR SINPVALTPA        60
     GQMFRGLAAD ILRSMYAARN LVNGYDQFAA SDQVVRFAVA HTLVFTLFPE WLKQLNSEVG       120
     HVTARVNAVN VPEGVQQLVE GECDLLLGYH HPQLPIVLDP NHFPFVSLGV ERILPVSSPD       180
     ARGKPVFQLP GTPDAPLPLL AYSSGAFLGN IVEMLLLNAT EPYVLHRCFE THMSEALKGM       240
     VVAGHGIGWL PESCVAKELA DGTLVCAGTG DWITELEIRL YRSARKRGLA AEQLWAYIMN       300
     RPRAAIDGAI GTEEAAAPAM RSARRSAGGS R                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page