(data stored in ACNUC1104 zone)

EMBL: CP000959.PE231

CP000959.PE231       Location/Qualifiers
FT   CDS             280306..282936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92572"
FT                   /db_xref="GOA:B1K1Z3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Z3"
FT                   /protein_id="ACA92572.1"
FT                   /translation="MANNRQQQCTTVVPPNRRVLLHAPLLCLLVASGPCLAAEGDAKPR
FT                   DASAIAGSHGAPDALPPDLQPTGASTQAAQGSGTQPPHAPTPIARASDASMQIAQASPA
FT                   MPTTVVVDPDAAQPSAPVPDATASNAPAPAAHAPNAPMLLAQAFDTVPPDAPAPRVPTS
FT                   DAPQQLAQTAPPAPPATPTLVAQASGTPMPNSPTPAAQPPGVEPPSSRQPGSQSPGAQL
FT                   PGEAIQRSQGPDVEAPNAQAPNLRTADVATVRNDVFGLAASGGAVKALDEAKARPDAFS
FT                   AVDIAQLEELSIRQQVRGGRDKSRSMTSSDRFDGLDNALRAADDLDKRIPATPEYTPVR
FT                   TALAGDRVVALAARGDMKAAVTTFETIPSNAEISIDALAAVGDAYLYLSEPAKANAVYA
FT                   RALQQATASPTDRATRGFQYGARTQPIELREGLFWSYVDQARAPEAKQVLDDMEKSLPP
FT                   VKQVTNVGPGESDYLRYYRLRAQYLIFTGHVDQGIAALEQLEKEVPFNAEVRAAHADAV
FT                   SGQSHPRQAISMYRASLTDHPDSVEMLAGLGRASLTADDYATAKTVDQTLGNTFPDSGA
FT                   VRGFKRDYNAYRSPVFTTDLSFEHGNSALADNSFTSDSYLYSQPFGDNWRVFSHTFFGH
FT                   AQTDGGSVSRTRTGIGGDYRHGPLTVLGEVTRSMGGDGRTGGRGTIAYALNDYWTVNAG
FT                   LDTNDNSLPWKAYAAHIWGRSANVEVVYRQNDRREVKLSYGVSRYSDSNFHQEIAATAT
FT                   QRVYTSANQLVNVSLNLGTDSNTRQDAPYFSPGRDYAAAATVMHQLTLWKKGDTGLQQR
FT                   VSVSGGVYNERGFGTSPLWSARLEHAWTFKHDITLSYGVEVSSHAYDGQRERSETGFLS
FT                   LNLPF"
     MANNRQQQCT TVVPPNRRVL LHAPLLCLLV ASGPCLAAEG DAKPRDASAI AGSHGAPDAL        60
     PPDLQPTGAS TQAAQGSGTQ PPHAPTPIAR ASDASMQIAQ ASPAMPTTVV VDPDAAQPSA       120
     PVPDATASNA PAPAAHAPNA PMLLAQAFDT VPPDAPAPRV PTSDAPQQLA QTAPPAPPAT       180
     PTLVAQASGT PMPNSPTPAA QPPGVEPPSS RQPGSQSPGA QLPGEAIQRS QGPDVEAPNA       240
     QAPNLRTADV ATVRNDVFGL AASGGAVKAL DEAKARPDAF SAVDIAQLEE LSIRQQVRGG       300
     RDKSRSMTSS DRFDGLDNAL RAADDLDKRI PATPEYTPVR TALAGDRVVA LAARGDMKAA       360
     VTTFETIPSN AEISIDALAA VGDAYLYLSE PAKANAVYAR ALQQATASPT DRATRGFQYG       420
     ARTQPIELRE GLFWSYVDQA RAPEAKQVLD DMEKSLPPVK QVTNVGPGES DYLRYYRLRA       480
     QYLIFTGHVD QGIAALEQLE KEVPFNAEVR AAHADAVSGQ SHPRQAISMY RASLTDHPDS       540
     VEMLAGLGRA SLTADDYATA KTVDQTLGNT FPDSGAVRGF KRDYNAYRSP VFTTDLSFEH       600
     GNSALADNSF TSDSYLYSQP FGDNWRVFSH TFFGHAQTDG GSVSRTRTGI GGDYRHGPLT       660
     VLGEVTRSMG GDGRTGGRGT IAYALNDYWT VNAGLDTNDN SLPWKAYAAH IWGRSANVEV       720
     VYRQNDRREV KLSYGVSRYS DSNFHQEIAA TATQRVYTSA NQLVNVSLNL GTDSNTRQDA       780
     PYFSPGRDYA AAATVMHQLT LWKKGDTGLQ QRVSVSGGVY NERGFGTSPL WSARLEHAWT       840
     FKHDITLSYG VEVSSHAYDG QRERSETGFL SLNLPF                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page