(data stored in ACNUC1104 zone)

EMBL: CP000959.PE236

CP000959.PE236       Location/Qualifiers
FT   CDS             288753..289988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92577"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Z8"
FT                   /protein_id="ACA92577.1"
FT                   /translation="MRLAMAALCGAGGIGTASPPAFAGAPVVHTVTVPSAPTPQDTGDP
FT                   RRFMHGIGVADAGDGKRWVFFSSSGIVPRGALRGGSWPHDVYVGEWAPGEPRVLRVRTF
FT                   ISRPEAQEPVSIAQNAHGDIFVTFEDGWNTSQEVSQRYGVYRRDLKPIKPYPNDVESGG
FT                   HSGHVATVADRFVVFYSADWVNGGGVDNLGSGNGVYLKTYDAAGRVLNHVAVAPRRREW
FT                   WPVIAGSPRNALLVWQKFIDGSTDATLEYAMFDPVTAKLDKLGSLNDAIQYYVYSAAYV
FT                   PEIDRFIVVTTTADERGVAMLIAPDGRRTATLDCLPASVRESGLGVAGTHAYVPTRDGR
FT                   LLTLALTPADMKVSGVQRSPIPWGSTGIAGFPARGTAMHFVSLTPSGLREADFDPKQDT
FT                   SMPQNDVSCSSH"
     MRLAMAALCG AGGIGTASPP AFAGAPVVHT VTVPSAPTPQ DTGDPRRFMH GIGVADAGDG        60
     KRWVFFSSSG IVPRGALRGG SWPHDVYVGE WAPGEPRVLR VRTFISRPEA QEPVSIAQNA       120
     HGDIFVTFED GWNTSQEVSQ RYGVYRRDLK PIKPYPNDVE SGGHSGHVAT VADRFVVFYS       180
     ADWVNGGGVD NLGSGNGVYL KTYDAAGRVL NHVAVAPRRR EWWPVIAGSP RNALLVWQKF       240
     IDGSTDATLE YAMFDPVTAK LDKLGSLNDA IQYYVYSAAY VPEIDRFIVV TTTADERGVA       300
     MLIAPDGRRT ATLDCLPASV RESGLGVAGT HAYVPTRDGR LLTLALTPAD MKVSGVQRSP       360
     IPWGSTGIAG FPARGTAMHF VSLTPSGLRE ADFDPKQDTS MPQNDVSCSS H                411
//

If you have problems or comments...

PBIL Back to PBIL home page