(data stored in ACNUC1104 zone)

EMBL: CP000959.PE239

CP000959.PE239       Location/Qualifiers
FT   CDS             complement(292397..292921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92580"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:B1K201"
FT                   /protein_id="ACA92580.1"
FT                   /translation="MTEVNPTSAAAPEDSRLGILARRRIEAEIIKPIYEIMKREFGAER
FT                   AQAVIAEAVRGAAVDAGRTFAAQEPDGTSVKSFIALQVLWEKDDALDVEVRRADDAHYD
FT                   YDVHRCSYAEMYHAMGLGEIGHLLSCARDSYFIQGYAPDIALTRTSTIMQGGKRCDFRY
FT                   ALQRAPENGDA"
     MTEVNPTSAA APEDSRLGIL ARRRIEAEII KPIYEIMKRE FGAERAQAVI AEAVRGAAVD        60
     AGRTFAAQEP DGTSVKSFIA LQVLWEKDDA LDVEVRRADD AHYDYDVHRC SYAEMYHAMG       120
     LGEIGHLLSC ARDSYFIQGY APDIALTRTS TIMQGGKRCD FRYALQRAPE NGDA             174
//

If you have problems or comments...

PBIL Back to PBIL home page