(data stored in ACNUC1104 zone)

EMBL: CP000959.PE24

CP000959.PE24        Location/Qualifiers
FT   CDS             26169..26660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3209"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bvi:Bcep1808_4860 cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92365"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:B1K885"
FT                   /protein_id="ACA92365.1"
FT                   /translation="MTQPSAPLSTDLPPISCLPGDALPWLPMSADLPGLAIKYLHINAA
FT                   EDTLTALLKMPAGGVLPRHRHDGEVFVHTLQGAWRYREYDWVAHAGSTVLEPAGSVHTP
FT                   ETLGAPGEDVITLNVMRGDLVLLDDDGRETARENCRVALLRQRKHARTAPDAATAFVTR
FT                   "
     MTQPSAPLST DLPPISCLPG DALPWLPMSA DLPGLAIKYL HINAAEDTLT ALLKMPAGGV        60
     LPRHRHDGEV FVHTLQGAWR YREYDWVAHA GSTVLEPAGS VHTPETLGAP GEDVITLNVM       120
     RGDLVLLDDD GRETARENCR VALLRQRKHA RTAPDAATAF VTR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page