(data stored in ACNUC1104 zone)

EMBL: CP000959.PE242

CP000959.PE242       Location/Qualifiers
FT   CDS             295286..295504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92583"
FT                   /db_xref="GOA:B1K204"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B1K204"
FT                   /protein_id="ACA92583.1"
FT                   /translation="MSRILVDLSDGQLDELAVIVETQHRPRAAIIRDAIDAYIALNKHR
FT                   LADDVFGLWKDRTVDGLAYQEELRSEW"
     MSRILVDLSD GQLDELAVIV ETQHRPRAAI IRDAIDAYIA LNKHRLADDV FGLWKDRTVD        60
     GLAYQEELRS EW                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page