(data stored in ACNUC1104 zone)

EMBL: CP000959.PE246

CP000959.PE246       Location/Qualifiers
FT   CDS             complement(298537..299349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92587"
FT                   /db_xref="UniProtKB/TrEMBL:B1K208"
FT                   /protein_id="ACA92587.1"
FT                   /translation="MTSTRKTIMIAGGLLVATAGTAYVMLLRADHRAIEDAGIGDSAAP
FT                   VAAAPAGNDHAVQGAIAPPAPAAATAPKQAAAAPPPAPTTSTPAPAATARVDAAPAPVP
FT                   VVSDKPQPVTKPAAPPPKVNVVTVNPEDSTPPAPAPAQTATVQPTQSVQPARSAAPAQS
FT                   TQRAPVTQRAPRKRDGLERHAAAPPAATKSETPETAALVRESAKLDPSLPPPSISSMPA
FT                   STGSYRQGSASSGANPVAAAMTEQLVRQSSSFKSTAPVPADGGTTTAK"
     MTSTRKTIMI AGGLLVATAG TAYVMLLRAD HRAIEDAGIG DSAAPVAAAP AGNDHAVQGA        60
     IAPPAPAAAT APKQAAAAPP PAPTTSTPAP AATARVDAAP APVPVVSDKP QPVTKPAAPP       120
     PKVNVVTVNP EDSTPPAPAP AQTATVQPTQ SVQPARSAAP AQSTQRAPVT QRAPRKRDGL       180
     ERHAAAPPAA TKSETPETAA LVRESAKLDP SLPPPSISSM PASTGSYRQG SASSGANPVA       240
     AAMTEQLVRQ SSSFKSTAPV PADGGTTTAK                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page