(data stored in ACNUC1104 zone)

EMBL: CP000959.PE25

CP000959.PE25        Location/Qualifiers
FT   CDS             complement(26766..27914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3210"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: Epoxide hydrolase domain protein; KEGG:
FT                   bur:Bcep18194_B1704 epoxide hydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92366"
FT                   /db_xref="GOA:B1K886"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1K886"
FT                   /protein_id="ACA92366.1"
FT                   /translation="MHAEPFDIAISDQALDDLRRRVRDTRPPNLTPAEPWQQGVDGAWL
FT                   RELAAYWADGFDWRAAERALNRLPQFVADVGGRRVHFVHRRGTGPKPYPLVVTHGWPGS
FT                   AFEFHALIDRLCNPAAFGGDPADAFDIVAPSLPGFLFSPAPAAPGTSALQVADCWAALM
FT                   AGLGYPRFGAQGGDLGAGVSVALGARHEGVVDGIHLNYLPGSYDPPLDAARPLTDDEQA
FT                   FLKQRGEWAALEGGYAYVHMTKPQTLAVALNDSPLGLAAWIGEKFRAWSDCDGDVARRF
FT                   SHDTLLTGISLYWFTGCIGSSMQMYWENRLQPMRFAPGQRLAVPVGFARFPKEISRPPR
FT                   SWLERVFDVVQWTDMPSGGHFAAMEEPDLLADDIRRFFRRFR"
     MHAEPFDIAI SDQALDDLRR RVRDTRPPNL TPAEPWQQGV DGAWLRELAA YWADGFDWRA        60
     AERALNRLPQ FVADVGGRRV HFVHRRGTGP KPYPLVVTHG WPGSAFEFHA LIDRLCNPAA       120
     FGGDPADAFD IVAPSLPGFL FSPAPAAPGT SALQVADCWA ALMAGLGYPR FGAQGGDLGA       180
     GVSVALGARH EGVVDGIHLN YLPGSYDPPL DAARPLTDDE QAFLKQRGEW AALEGGYAYV       240
     HMTKPQTLAV ALNDSPLGLA AWIGEKFRAW SDCDGDVARR FSHDTLLTGI SLYWFTGCIG       300
     SSMQMYWENR LQPMRFAPGQ RLAVPVGFAR FPKEISRPPR SWLERVFDVV QWTDMPSGGH       360
     FAAMEEPDLL ADDIRRFFRR FR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page