(data stored in ACNUC1104 zone)

EMBL: CP000959.PE252

CP000959.PE252       Location/Qualifiers
FT   CDS             complement(304338..304994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3440"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bur:Bcep18194_B1960
FT                   glutamine ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92593"
FT                   /db_xref="GOA:B1K214"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1K214"
FT                   /protein_id="ACA92593.1"
FT                   /translation="MNFDWSAIWAALPDLMDGVRLTVFIALLGLVGGFIVGMIAGMFRA
FT                   YGPKAMNVLAQVYIELIRGTPIVVQVMFLYFALPLLAHIRIDGLTAAIIAITVNSGAYL
FT                   AEVVRGALLSIPKGLTEAGLAMGLSMPRVLLKIVGPLAFRRLIPPLGNQCIVSLKDTSL
FT                   FIVIGVGELTRKGQEIIAGNFQAVEIWSAVAVIYLILTGAMTLTLRIVEKRMRIL"
     MNFDWSAIWA ALPDLMDGVR LTVFIALLGL VGGFIVGMIA GMFRAYGPKA MNVLAQVYIE        60
     LIRGTPIVVQ VMFLYFALPL LAHIRIDGLT AAIIAITVNS GAYLAEVVRG ALLSIPKGLT       120
     EAGLAMGLSM PRVLLKIVGP LAFRRLIPPL GNQCIVSLKD TSLFIVIGVG ELTRKGQEII       180
     AGNFQAVEIW SAVAVIYLIL TGAMTLTLRI VEKRMRIL                               218
//

If you have problems or comments...

PBIL Back to PBIL home page