(data stored in ACNUC1104 zone)

EMBL: CP000959.PE253

CP000959.PE253       Location/Qualifiers
FT   CDS             complement(305061..305813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3441"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG:
FT                   bur:Bcep18194_B1961 glutamine ABC transporter periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92594"
FT                   /db_xref="GOA:B1K215"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B1K215"
FT                   /protein_id="ACA92594.1"
FT                   /translation="MSRRSFLKAVAVAAALGASLAHADTKTLVVGTDTSFMPFEFKQGD
FT                   KYVGFDLDLWAEIAKDQGWKYTIQPMDFAGLIPALQTQNIDVALSGMTIKEERKKAIDF
FT                   SAPYYDSGLAAMVQAGNTSIKSIDDLNGKVIAAKTGTATIDWIKAHLKPKEVRQFPNID
FT                   QAYLALEAGRVDAAMHDTPNVLFFVNNEGKGKVQVAGQPVSGDKYGIGFPKGSALVPKV
FT                   NASLVKIKADGRYAQIYKKWFGAEPPKM"
     MSRRSFLKAV AVAAALGASL AHADTKTLVV GTDTSFMPFE FKQGDKYVGF DLDLWAEIAK        60
     DQGWKYTIQP MDFAGLIPAL QTQNIDVALS GMTIKEERKK AIDFSAPYYD SGLAAMVQAG       120
     NTSIKSIDDL NGKVIAAKTG TATIDWIKAH LKPKEVRQFP NIDQAYLALE AGRVDAAMHD       180
     TPNVLFFVNN EGKGKVQVAG QPVSGDKYGI GFPKGSALVP KVNASLVKIK ADGRYAQIYK       240
     KWFGAEPPKM                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page