(data stored in ACNUC1104 zone)

EMBL: CP000959.PE254

CP000959.PE254       Location/Qualifiers
FT   CDS             complement(306325..309864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3442"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="KEGG: bur:Bcep18194_B1962 ABC efflux pump, fused
FT                   ATPase and inner membrane subunits; TIGRFAM: ABC
FT                   transporter, CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92595"
FT                   /db_xref="GOA:B1K216"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B1K216"
FT                   /protein_id="ACA92595.1"
FT                   /translation="MYFDRRLWAMMAGLRWRVAAAVALGLLAMGVGILRFVFLGRVLAL
FT                   VFSGAPARSIGEVVVATAACVLLRAWLDHRRTVLAQHTAGRVQATLRARLFDRIAALGP
FT                   AWFSGERTGGVMLAVVDGVEQLQTFFGVYLPQLVIAACAPIMIFAVLAWWDVPTAAVLL
FT                   VAALVTLALPQLVHRADKRAALARSTAFKAFGEEFLDAVQGLPTLKAFGQSAAFGAKLA
FT                   AKARALSDSTFWVLALGLLTRLFTDLGTGLGAAAAIAVGAWRVRHGDMSLEALLIVLMA
FT                   GSEIFRPLRDLRAVLHQGMIGQSAANAIHALLDAGSHAPTVDAPRVPGLRPEIAFDHVS
FT                   FAYPGRRADAHAALSFTVREGETVAIVGPSGAGKSTIVRLLLRQHDAQGGVVRIGGHDV
FT                   RTLDADQVRDMIAVVAQDATLFDGSVADNLRLGRPAASDADMIAAARAANAHDFISALP
FT                   DGYATRIGERGLMLSGGQRQRIAIARALLRDAPILLLDEALSSVDAENEALIQQALDRL
FT                   TRGRTTLVLAHRLSSVIGADRILVLDQGQVVDEGTHAALIARDGPYRRLMGPQLEAVAE
FT                   SVGATEAAGTTARASSGPQVRPLNDDAATIGWPETLQTLLRFVRPWKGKVVLTVLFGIG
FT                   RVLAFIGVGVLGARVVGAVPSGHVGTGLVAALLVIAPVAAVLHWLESWLAHDMAYRLLA
FT                   EMRIALFATLERLAPAGLLRRRSGDLVSLATQDVETVEYFYAHTLAPAFVAVLVPAGVL
FT                   VLLASVAWPLALVLLPFLLWAGLAPVLARRDVDRLGTGARDALGQLGAHLTETIQGLAE
FT                   LTAFQAIARRRAAFVAEVDAYRQQRAKLLDDLSTQSAALEVASGLGGLAVAALGAWWCA
FT                   RGGFPRESLPLLVLVAVAAFMPVAEIGQVARQLADTIASTRRLRALEKEPVTVTDGAHA
FT                   MPGNPAVRFEAASFTYPGRSVPAIDRVSFEVPPGSTVALVGASGAGKSTVASLLLRFWD
FT                   PQQGRVTLGGVDLRDLRLDDLRQHIALVAQDTYLFNDTLEANIRLAANDASDADVQRAI
FT                   DHAALGDFVARLPDGLATRVGERGVQLSGGQRQRVAIARAFLKDAPVLILDEATSHLDT
FT                   ISEQQIRAALEELMTQRTSIIIAHRLSTVRNADLILVMEQGAVIEAGGHAELLARQGAY
FT                   ARLVSHQASGVAA"
     MYFDRRLWAM MAGLRWRVAA AVALGLLAMG VGILRFVFLG RVLALVFSGA PARSIGEVVV        60
     ATAACVLLRA WLDHRRTVLA QHTAGRVQAT LRARLFDRIA ALGPAWFSGE RTGGVMLAVV       120
     DGVEQLQTFF GVYLPQLVIA ACAPIMIFAV LAWWDVPTAA VLLVAALVTL ALPQLVHRAD       180
     KRAALARSTA FKAFGEEFLD AVQGLPTLKA FGQSAAFGAK LAAKARALSD STFWVLALGL       240
     LTRLFTDLGT GLGAAAAIAV GAWRVRHGDM SLEALLIVLM AGSEIFRPLR DLRAVLHQGM       300
     IGQSAANAIH ALLDAGSHAP TVDAPRVPGL RPEIAFDHVS FAYPGRRADA HAALSFTVRE       360
     GETVAIVGPS GAGKSTIVRL LLRQHDAQGG VVRIGGHDVR TLDADQVRDM IAVVAQDATL       420
     FDGSVADNLR LGRPAASDAD MIAAARAANA HDFISALPDG YATRIGERGL MLSGGQRQRI       480
     AIARALLRDA PILLLDEALS SVDAENEALI QQALDRLTRG RTTLVLAHRL SSVIGADRIL       540
     VLDQGQVVDE GTHAALIARD GPYRRLMGPQ LEAVAESVGA TEAAGTTARA SSGPQVRPLN       600
     DDAATIGWPE TLQTLLRFVR PWKGKVVLTV LFGIGRVLAF IGVGVLGARV VGAVPSGHVG       660
     TGLVAALLVI APVAAVLHWL ESWLAHDMAY RLLAEMRIAL FATLERLAPA GLLRRRSGDL       720
     VSLATQDVET VEYFYAHTLA PAFVAVLVPA GVLVLLASVA WPLALVLLPF LLWAGLAPVL       780
     ARRDVDRLGT GARDALGQLG AHLTETIQGL AELTAFQAIA RRRAAFVAEV DAYRQQRAKL       840
     LDDLSTQSAA LEVASGLGGL AVAALGAWWC ARGGFPRESL PLLVLVAVAA FMPVAEIGQV       900
     ARQLADTIAS TRRLRALEKE PVTVTDGAHA MPGNPAVRFE AASFTYPGRS VPAIDRVSFE       960
     VPPGSTVALV GASGAGKSTV ASLLLRFWDP QQGRVTLGGV DLRDLRLDDL RQHIALVAQD      1020
     TYLFNDTLEA NIRLAANDAS DADVQRAIDH AALGDFVARL PDGLATRVGE RGVQLSGGQR      1080
     QRVAIARAFL KDAPVLILDE ATSHLDTISE QQIRAALEEL MTQRTSIIIA HRLSTVRNAD      1140
     LILVMEQGAV IEAGGHAELL ARQGAYARLV SHQASGVAA                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page