(data stored in ACNUC1104 zone)

EMBL: CP000959.PE256

CP000959.PE256       Location/Qualifiers
FT   CDS             complement(310976..311347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3444"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1964 membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92597"
FT                   /db_xref="GOA:B1K218"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B1K218"
FT                   /protein_id="ACA92597.1"
FT                   /translation="MTTSQLCLFIVALLPFPMTFLAKARKGYDNRAPRDYLAKLEGWRA
FT                   RAQAAHQNAWEALALFTAALVVAWHNGANVHRVDQLAMAFVAIRIVYALMYLLNWASLR
FT                   SLVWFGGMACIVALFFATP"
     MTTSQLCLFI VALLPFPMTF LAKARKGYDN RAPRDYLAKL EGWRARAQAA HQNAWEALAL        60
     FTAALVVAWH NGANVHRVDQ LAMAFVAIRI VYALMYLLNW ASLRSLVWFG GMACIVALFF       120
     ATP                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page