(data stored in ACNUC1104 zone)

EMBL: CP000959.PE257

CP000959.PE257       Location/Qualifiers
FT   CDS             311650..312771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3445"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: bur:Bcep18194_B1965 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92598"
FT                   /db_xref="GOA:B1K219"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1K219"
FT                   /protein_id="ACA92598.1"
FT                   /translation="MPRPIVAHIRPDAVRHNLDFIRRTAAQSRVWAVVKANAYGHGIER
FT                   IYPGLAAADGIGLLDLDEAVRVRELGWDKPVLLLEGVFEPADVELADRHRLTVAVHCDE
FT                   QLDLLIAAKPRQPIDIQLKMNSGMNRLGYRPAAFRAAWERAANAPSIGKITLMMHFANA
FT                   DEGEVDWQLDQFDATTAGIPGERSVSNSAAVLWHPRAHRDWVRPGTILYGASPTGAARH
FT                   IADTPLMAAMTLSSKIIGVQTLAPDETVGYGRRFTADRPMRIGVVACGYADGYPRHAPT
FT                   GTPIAVDGVMTRVVGRVSMDMLTVDLTPCPNAGIGSRVELWGDQVKVDDVAQASGTIGY
FT                   ELMCALARRVPVVIVPPGAASVQPALRTGSYGR"
     MPRPIVAHIR PDAVRHNLDF IRRTAAQSRV WAVVKANAYG HGIERIYPGL AAADGIGLLD        60
     LDEAVRVREL GWDKPVLLLE GVFEPADVEL ADRHRLTVAV HCDEQLDLLI AAKPRQPIDI       120
     QLKMNSGMNR LGYRPAAFRA AWERAANAPS IGKITLMMHF ANADEGEVDW QLDQFDATTA       180
     GIPGERSVSN SAAVLWHPRA HRDWVRPGTI LYGASPTGAA RHIADTPLMA AMTLSSKIIG       240
     VQTLAPDETV GYGRRFTADR PMRIGVVACG YADGYPRHAP TGTPIAVDGV MTRVVGRVSM       300
     DMLTVDLTPC PNAGIGSRVE LWGDQVKVDD VAQASGTIGY ELMCALARRV PVVIVPPGAA       360
     SVQPALRTGS YGR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page