(data stored in ACNUC1104 zone)

EMBL: CP000959.PE260

CP000959.PE260       Location/Qualifiers
FT   CDS             315526..316401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3448"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_3487 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92601"
FT                   /db_xref="GOA:B1K222"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K222"
FT                   /protein_id="ACA92601.1"
FT                   /translation="MNWDNARFFLALARTGTLRGAAAQLNVDQATVGRRIAALEDELSA
FT                   RLFLRTPSLYVLTTAGEALLEPAETMERASLTIERRVMGLDEQLAGSVRIATTDTLGKR
FT                   FVVPAIANLRRRHAGIDVVCVTSAQITNLTRREADLAIRTLRPESPDLIVRRLGHLETG
FT                   IYASRRYLAERGEPVAGSAFDGHDLVMYQQPVVPTMWDALCGEPTSRGRVMFQTSSTMM
FT                   LVEAALAGLGIAELPCFRADTEPDLVRLMPQRCNHFDVWLVAHADLYKTARVQAVIEAV
FT                   VDEFATAASR"
     MNWDNARFFL ALARTGTLRG AAAQLNVDQA TVGRRIAALE DELSARLFLR TPSLYVLTTA        60
     GEALLEPAET MERASLTIER RVMGLDEQLA GSVRIATTDT LGKRFVVPAI ANLRRRHAGI       120
     DVVCVTSAQI TNLTRREADL AIRTLRPESP DLIVRRLGHL ETGIYASRRY LAERGEPVAG       180
     SAFDGHDLVM YQQPVVPTMW DALCGEPTSR GRVMFQTSST MMLVEAALAG LGIAELPCFR       240
     ADTEPDLVRL MPQRCNHFDV WLVAHADLYK TARVQAVIEA VVDEFATAAS R                291
//

If you have problems or comments...

PBIL Back to PBIL home page