(data stored in ACNUC1104 zone)

EMBL: CP000959.PE262

CP000959.PE262       Location/Qualifiers
FT   CDS             complement(317510..317962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92603"
FT                   /db_xref="GOA:B1K224"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:B1K224"
FT                   /protein_id="ACA92603.1"
FT                   /translation="MASEIGRPAAQHIEWRIAKGIVFTIVGTCMLIGTALYAQSTREFL
FT                   RTSVVVPGRVVKLNAGPHHPEITFTTLAGEQVDYAQGGEVSVEDGATVEVRYAPDAPRT
FT                   TARMNTFGAIWGTVLTIGAMGMVFFAVGVGQLWSGVRMWRSGRKRT"
     MASEIGRPAA QHIEWRIAKG IVFTIVGTCM LIGTALYAQS TREFLRTSVV VPGRVVKLNA        60
     GPHHPEITFT TLAGEQVDYA QGGEVSVEDG ATVEVRYAPD APRTTARMNT FGAIWGTVLT       120
     IGAMGMVFFA VGVGQLWSGV RMWRSGRKRT                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page