(data stored in ACNUC1104 zone)

EMBL: CP000959.PE263

CP000959.PE263       Location/Qualifiers
FT   CDS             complement(318108..318473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3451"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bvi:Bcep1808_4641 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92604"
FT                   /db_xref="GOA:B1K2F9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2F9"
FT                   /protein_id="ACA92604.1"
FT                   /translation="MAKILVVDDSGTVRDEVAGFLRNHGLDVATAVDGKDGLAKLKATP
FT                   GVRLVISDVNMPNMDGLTMVEKIRGELANTAVNVVMLTTESSPAMKERGKAAGVKGWIV
FT                   KPFKGDAVLDALKKLAG"
     MAKILVVDDS GTVRDEVAGF LRNHGLDVAT AVDGKDGLAK LKATPGVRLV ISDVNMPNMD        60
     GLTMVEKIRG ELANTAVNVV MLTTESSPAM KERGKAAGVK GWIVKPFKGD AVLDALKKLA       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page