(data stored in ACNUC1104 zone)

EMBL: CP000959.PE265

CP000959.PE265       Location/Qualifiers
FT   CDS             complement(319495..320076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92606"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2G1"
FT                   /protein_id="ACA92606.1"
FT                   /translation="MISAQARAGFERIFFDAARTRLAAGGTCDIRPAAGHDPDAPDRRY
FT                   AKSRSKPKVPEHVVVLTISALHFRLLLALRFSDDDATRRHFAGATAGTNSQRPLTDAFM
FT                   EVANLCCGAINQALTTPFPDLGMSTPYLLSGASIDYLHALAPDYVAAYDLTLDGDVRVG
FT                   ATLCVCANAPVDFHVPETAAVDTGGELELF"
     MISAQARAGF ERIFFDAART RLAAGGTCDI RPAAGHDPDA PDRRYAKSRS KPKVPEHVVV        60
     LTISALHFRL LLALRFSDDD ATRRHFAGAT AGTNSQRPLT DAFMEVANLC CGAINQALTT       120
     PFPDLGMSTP YLLSGASIDY LHALAPDYVA AYDLTLDGDV RVGATLCVCA NAPVDFHVPE       180
     TAAVDTGGEL ELF                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page