(data stored in ACNUC1104 zone)

EMBL: CP000959.PE267

CP000959.PE267       Location/Qualifiers
FT   CDS             complement(320824..323211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3455"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART: PAC
FT                   repeat-containing protein; KEGG: bur:Bcep18194_B1979
FT                   putative CheA signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92608"
FT                   /db_xref="GOA:B1K2G3"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2G3"
FT                   /protein_id="ACA92608.1"
FT                   /translation="MTIRHRITLLVVLTFFALSAIGIYAVYQTRKSASEVRQVTQGIVP
FT                   SALASADLVADVKNIQIATMTLLYAPDANTAAQARDELKAKQAALRAALDAQAKSAVGQ
FT                   AQVGLVAQAKDSAVNYFAAIADTVKMKTDGKPEMAQAYLFANVAQYRDELESIVDTLRV
FT                   EKNRQKDDAIGALNGMLATTATAIAGVAGTVIVLLTALGFVLYRQITRPLIGMQTAMSE
FT                   IATSQDFTRRVPVGRMDEIGHSIVAFNGMIEKIQENAAQLKQKTADIQAMLQNMQQGIL
FT                   TVVEGGVVHAEYSAYLETIFETNDIAGRDLMALVFDDSAIGADARSQVDAAVHACLGED
FT                   SMNFGFNEHLLVNEVAKRMPDGREKWLDLSWSAITDETDTVVRLMLCVRDVTEIRELTA
FT                   QAGEQQRRLEMIGEILSISQDKFHDFVHSAKGFLSENERMIRQHERVDHSIVAALFRNM
FT                   HTIKGNARTYSLQHLTNIVHEAEQAYESLRRADSGPEWNRDALMEDLARVREAVDHYAT
FT                   INAVTLGRSGEPAPNGADFLMVERAHISESLRVLDGADPANASDWHAARDAVRRMLSQL
FT                   GTQGIGEALGGVIESLPSLAAELGKPAPVVHIDSHGQRVRSEIVATLKNVFMHLLRNAV
FT                   DHGIESSDARRAAGKPASGTIDISVGVGGGELWFVLADDGRGLALDRIRGIARERGWID
FT                   AGNEAALSDEDVAELIFRPGFSTAQTVTEVSGRGVGMDAVRNFLKRDGGDIALRFTDDH
FT                   VGAPYRAFETIVSLPARFAADGAAPGTGHAQRARVADIDAAE"
     MTIRHRITLL VVLTFFALSA IGIYAVYQTR KSASEVRQVT QGIVPSALAS ADLVADVKNI        60
     QIATMTLLYA PDANTAAQAR DELKAKQAAL RAALDAQAKS AVGQAQVGLV AQAKDSAVNY       120
     FAAIADTVKM KTDGKPEMAQ AYLFANVAQY RDELESIVDT LRVEKNRQKD DAIGALNGML       180
     ATTATAIAGV AGTVIVLLTA LGFVLYRQIT RPLIGMQTAM SEIATSQDFT RRVPVGRMDE       240
     IGHSIVAFNG MIEKIQENAA QLKQKTADIQ AMLQNMQQGI LTVVEGGVVH AEYSAYLETI       300
     FETNDIAGRD LMALVFDDSA IGADARSQVD AAVHACLGED SMNFGFNEHL LVNEVAKRMP       360
     DGREKWLDLS WSAITDETDT VVRLMLCVRD VTEIRELTAQ AGEQQRRLEM IGEILSISQD       420
     KFHDFVHSAK GFLSENERMI RQHERVDHSI VAALFRNMHT IKGNARTYSL QHLTNIVHEA       480
     EQAYESLRRA DSGPEWNRDA LMEDLARVRE AVDHYATINA VTLGRSGEPA PNGADFLMVE       540
     RAHISESLRV LDGADPANAS DWHAARDAVR RMLSQLGTQG IGEALGGVIE SLPSLAAELG       600
     KPAPVVHIDS HGQRVRSEIV ATLKNVFMHL LRNAVDHGIE SSDARRAAGK PASGTIDISV       660
     GVGGGELWFV LADDGRGLAL DRIRGIARER GWIDAGNEAA LSDEDVAELI FRPGFSTAQT       720
     VTEVSGRGVG MDAVRNFLKR DGGDIALRFT DDHVGAPYRA FETIVSLPAR FAADGAAPGT       780
     GHAQRARVAD IDAAE                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page