(data stored in ACNUC1104 zone)

EMBL: CP000959.PE269

CP000959.PE269       Location/Qualifiers
FT   CDS             complement(324480..325985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3457"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1983 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92610"
FT                   /db_xref="GOA:B1K2G5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2G5"
FT                   /protein_id="ACA92610.1"
FT                   /translation="MTHPSERPAGPAGGADAAHADPDAMFASHEAGYAKQLKPRHVQMI
FT                   AMGGAIGTGLFLGAGGRLQSAGPALALVYLVCGVFAFLIMRALGELVMHRPTSGSFVSY
FT                   AREFMGERASFVAGWMYYLNWATTGIVDITAVAIYMKYWAVFTDVPQWVFALGALGIVS
FT                   VMNMIGVKVFGEMEFWFSLVKVGTLAVFLAVGAVFLASGHPVAGQMTGLHLVADHGGIF
FT                   PHGILPAVLIVQGVVFAYASIELVGVAAGETADARKVLPKAINSVMWRIALFYVGSVVL
FT                   LTMLLPWTAYSAHESPFVTFFSKLGVPYVGTVMNVVVLTAALSSLNSGLYSTGRVLRSL
FT                   AMGGSAPRFVSRMNARGVPYGGILITVAINAIGVPLNYIVPAQAFEIVLNMASLGIITT
FT                   WGFIVMCQILFRRAVDRGEMKAVSFRMPGAPFTSWLTLAFLVGVLVLMAFDYPGGTWTI
FT                   ATIPVVVLALVIGWKLAKRGAERERAAAMPASVRGVADPARNA"
     MTHPSERPAG PAGGADAAHA DPDAMFASHE AGYAKQLKPR HVQMIAMGGA IGTGLFLGAG        60
     GRLQSAGPAL ALVYLVCGVF AFLIMRALGE LVMHRPTSGS FVSYAREFMG ERASFVAGWM       120
     YYLNWATTGI VDITAVAIYM KYWAVFTDVP QWVFALGALG IVSVMNMIGV KVFGEMEFWF       180
     SLVKVGTLAV FLAVGAVFLA SGHPVAGQMT GLHLVADHGG IFPHGILPAV LIVQGVVFAY       240
     ASIELVGVAA GETADARKVL PKAINSVMWR IALFYVGSVV LLTMLLPWTA YSAHESPFVT       300
     FFSKLGVPYV GTVMNVVVLT AALSSLNSGL YSTGRVLRSL AMGGSAPRFV SRMNARGVPY       360
     GGILITVAIN AIGVPLNYIV PAQAFEIVLN MASLGIITTW GFIVMCQILF RRAVDRGEMK       420
     AVSFRMPGAP FTSWLTLAFL VGVLVLMAFD YPGGTWTIAT IPVVVLALVI GWKLAKRGAE       480
     RERAAAMPAS VRGVADPARN A                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page