(data stored in ACNUC1104 zone)

EMBL: CP000959.PE275

CP000959.PE275       Location/Qualifiers
FT   CDS             complement(332064..332387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92616"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H1"
FT                   /protein_id="ACA92616.1"
FT                   /translation="MDKLISYVAAIHGLAGSVSIVSHATSHDRWTDDDVEVIRDETEYR
FT                   FDNGAIVRRSVEQDRAPSDLLCAECWIDYDVLRHPDAQPINPSRLTFDNACRETFWLRY
FT                   HLA"
     MDKLISYVAA IHGLAGSVSI VSHATSHDRW TDDDVEVIRD ETEYRFDNGA IVRRSVEQDR        60
     APSDLLCAEC WIDYDVLRHP DAQPINPSRL TFDNACRETF WLRYHLA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page