(data stored in ACNUC1104 zone)

EMBL: CP000959.PE276

CP000959.PE276       Location/Qualifiers
FT   CDS             complement(332504..333526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92617"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H2"
FT                   /protein_id="ACA92617.1"
FT                   /translation="MTDRLTPELASKFAALALAHLTREYPNKLTHALEGPHDVQGPRAL
FT                   HPIFYGSYDWHSCVHGYWLVLRVLERYPALPEAERIVATVDAHFTDANVAGERAYLALP
FT                   HNAGFERPYGWAWLLALAAQLERLALKGALPQAARWAKTLAPLADLFVSRFETFLPKAT
FT                   YPLRVGTHFNTAFALALTLDFARDTQRDGLAALIVDTAKRWHLNDVACQAWEPSGDEFL
FT                   SPALMEAELMRRVLPAAEFDGWFARFLPDLAHGEPATLFEPATVSDRSDGKIAHLDGLN
FT                   LSRAWCQRSLAGALPEGDARRAKLLDAADRHLASALAHVAGDYMGEHWLATFALLALDA
FT                   "
     MTDRLTPELA SKFAALALAH LTREYPNKLT HALEGPHDVQ GPRALHPIFY GSYDWHSCVH        60
     GYWLVLRVLE RYPALPEAER IVATVDAHFT DANVAGERAY LALPHNAGFE RPYGWAWLLA       120
     LAAQLERLAL KGALPQAARW AKTLAPLADL FVSRFETFLP KATYPLRVGT HFNTAFALAL       180
     TLDFARDTQR DGLAALIVDT AKRWHLNDVA CQAWEPSGDE FLSPALMEAE LMRRVLPAAE       240
     FDGWFARFLP DLAHGEPATL FEPATVSDRS DGKIAHLDGL NLSRAWCQRS LAGALPEGDA       300
     RRAKLLDAAD RHLASALAHV AGDYMGEHWL ATFALLALDA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page