(data stored in ACNUC1104 zone)

EMBL: CP000959.PE277

CP000959.PE277       Location/Qualifiers
FT   CDS             complement(333546..334496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3465"
FT                   /product="protein of unknown function DUF979"
FT                   /note="PFAM: protein of unknown function DUF979; KEGG:
FT                   bur:Bcep18194_B2012 protein of unknown function DUF979"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92618"
FT                   /db_xref="GOA:B1K2H3"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H3"
FT                   /protein_id="ACA92618.1"
FT                   /translation="MIGLESLYTLAGLMFAAFAYFNLTDRTNPRRVVNFAFWAIYAVTF
FT                   LFGALLPHFVTGGLAIALAVIAGSGKLGRGRSDEAGEAAAGRRETLAQRFGNRLFLPAL
FT                   LIPLVTLIGTFALKLVPFVEPKSVTLISLVLGTIVAFVVALAMLRDSPVHALKEARHTM
FT                   DAVGWAAILPQMLAALGALFAVAGVGGVVSGLVKDWVPIDSPFAVVAAYTVGMALFTMI
FT                   MGNGFAAFPVMTAGIGLPLIVHQFHGNPAIMGAIGMLSGFCGTLMTPMAANFNIVPAAL
FT                   LELKDKNGVIKAQWPTAVLLLAVNTLLMYAFVFRF"
     MIGLESLYTL AGLMFAAFAY FNLTDRTNPR RVVNFAFWAI YAVTFLFGAL LPHFVTGGLA        60
     IALAVIAGSG KLGRGRSDEA GEAAAGRRET LAQRFGNRLF LPALLIPLVT LIGTFALKLV       120
     PFVEPKSVTL ISLVLGTIVA FVVALAMLRD SPVHALKEAR HTMDAVGWAA ILPQMLAALG       180
     ALFAVAGVGG VVSGLVKDWV PIDSPFAVVA AYTVGMALFT MIMGNGFAAF PVMTAGIGLP       240
     LIVHQFHGNP AIMGAIGMLS GFCGTLMTPM AANFNIVPAA LLELKDKNGV IKAQWPTAVL       300
     LLAVNTLLMY AFVFRF                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page