(data stored in ACNUC1104 zone)

EMBL: CP000959.PE279

CP000959.PE279       Location/Qualifiers
FT   CDS             335454..335678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_4533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92620"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H5"
FT                   /protein_id="ACA92620.1"
FT                   /translation="MIDVFQTIGSRAFSAHLAKDGMVTLMEQRHEVDRVTLATAYAALV
FT                   EEAEQEADLRDATVERMMRALIQGYARSH"
     MIDVFQTIGS RAFSAHLAKD GMVTLMEQRH EVDRVTLATA YAALVEEAEQ EADLRDATVE        60
     RMMRALIQGY ARSH                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page