(data stored in ACNUC1104 zone)

EMBL: CP000959.PE282

CP000959.PE282       Location/Qualifiers
FT   CDS             337550..338611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3470"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver; KEGG:
FT                   bur:Bcep18194_B2018 diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92623"
FT                   /db_xref="GOA:B1K2H8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H8"
FT                   /protein_id="ACA92623.1"
FT                   /translation="MTIDLTRPPGGPTASPADAPAMVLLVDDQTIVAEAVRRALVDEEG
FT                   IDFHYCPRSDDAMATAVETRPTVILQDLVMPGTDGLSLVKAYRANPATRDVPIIVLSTQ
FT                   EEPVIKSAAFASGANDYLVKLPDRIELVARIRYHSRSYLNLLQRDEAYRALRQSQQQLL
FT                   EANLELRRLTHSDGLTGLSNRRYLDEYLAAEWRRGARERSELSLLMIDVDNFKLYNDTY
FT                   GHVSGDSVLKQIASTIERCLGQSGDFAARFGGEEFAVVMPASSPGAARLLGEKIRLAVE
FT                   ALRLRHAHSSTGNHTVTISIGGASIVPAPGLPTTVLIEAADRALYRAKHEGKNRVEIDP
FT                   SSPPPGAGGFGAH"
     MTIDLTRPPG GPTASPADAP AMVLLVDDQT IVAEAVRRAL VDEEGIDFHY CPRSDDAMAT        60
     AVETRPTVIL QDLVMPGTDG LSLVKAYRAN PATRDVPIIV LSTQEEPVIK SAAFASGAND       120
     YLVKLPDRIE LVARIRYHSR SYLNLLQRDE AYRALRQSQQ QLLEANLELR RLTHSDGLTG       180
     LSNRRYLDEY LAAEWRRGAR ERSELSLLMI DVDNFKLYND TYGHVSGDSV LKQIASTIER       240
     CLGQSGDFAA RFGGEEFAVV MPASSPGAAR LLGEKIRLAV EALRLRHAHS STGNHTVTIS       300
     IGGASIVPAP GLPTTVLIEA ADRALYRAKH EGKNRVEIDP SSPPPGAGGF GAH              353
//

If you have problems or comments...

PBIL Back to PBIL home page