(data stored in ACNUC1104 zone)

EMBL: CP000959.PE283

CP000959.PE283       Location/Qualifiers
FT   CDS             complement(338924..341173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3471"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold domain protein; KEGG: bur:Bcep18194_B2019
FT                   diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains)
FT                   with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92624"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H9"
FT                   /protein_id="ACA92624.1"
FT                   /translation="MNTEPQSSRYSLGLAAEVLASEQSVLRLITRNTPLPELLVEVCRR
FT                   AEALLGDGACCTILLLDTDGVHVRVGAAPSLPAQYSAAIDGATIGPAAGSCGTAMYERR
FT                   MIAVEDIETDPLWADYRAIALPLGLRACWSVPFLDEAGAVLGAFAVYHHRPCRPSDEET
FT                   ALLRDIGNSVGLAVHQDRIARQLARSEEHHRLVVNSLSEGILVISREGIVIASNPSANR
FT                   MMRVKGELVGRRLSTVILRKLREDGTPIDPHDWPSRRALETATPMLDYTVGFGLADGDI
FT                   IWVRGNAVPIVRPGETQADSVLVSFNDIGPVREAQQQLRYMATRDALTGLYNRRWLGDR
FT                   MRELFCVRDAAAGPARVAILFIDLVGFKKVNDTAGHDAGDALLRSVAARLAACGEGRYA
FT                   LTRVGGDEFVILVDDCDDPDRLSVLAREVIEAIAKPFAIANNEYWLGVSIGISVAPRDG
FT                   DDAATLMRNADSAMYDAKQRGRNHFTFFTAQLNLRLQRRFAIEQSLRRALASDLLRLAY
FT                   QPVVDARSGRTVGAEALLRWTSPELGPMSPAEFIPVAEDTGLIVAIGQWVLETACRQVA
FT                   EWRRTIAPDLMLAVNLSPRQFHEGLVESVGRCLAQTRLDPSALELEITEGVLMNDTDTV
FT                   LPMLEALTDMNVRISVDDFGTGYSSLAYLKRFPLHNLKVDRSFVSGVPDHHDSVAITQA
FT                   VVAMAHSLGMKVTAEGVETQAQSWFLQQIGCDMQQGYLFSRPLDASDYARRLGAA"
     MNTEPQSSRY SLGLAAEVLA SEQSVLRLIT RNTPLPELLV EVCRRAEALL GDGACCTILL        60
     LDTDGVHVRV GAAPSLPAQY SAAIDGATIG PAAGSCGTAM YERRMIAVED IETDPLWADY       120
     RAIALPLGLR ACWSVPFLDE AGAVLGAFAV YHHRPCRPSD EETALLRDIG NSVGLAVHQD       180
     RIARQLARSE EHHRLVVNSL SEGILVISRE GIVIASNPSA NRMMRVKGEL VGRRLSTVIL       240
     RKLREDGTPI DPHDWPSRRA LETATPMLDY TVGFGLADGD IIWVRGNAVP IVRPGETQAD       300
     SVLVSFNDIG PVREAQQQLR YMATRDALTG LYNRRWLGDR MRELFCVRDA AAGPARVAIL       360
     FIDLVGFKKV NDTAGHDAGD ALLRSVAARL AACGEGRYAL TRVGGDEFVI LVDDCDDPDR       420
     LSVLAREVIE AIAKPFAIAN NEYWLGVSIG ISVAPRDGDD AATLMRNADS AMYDAKQRGR       480
     NHFTFFTAQL NLRLQRRFAI EQSLRRALAS DLLRLAYQPV VDARSGRTVG AEALLRWTSP       540
     ELGPMSPAEF IPVAEDTGLI VAIGQWVLET ACRQVAEWRR TIAPDLMLAV NLSPRQFHEG       600
     LVESVGRCLA QTRLDPSALE LEITEGVLMN DTDTVLPMLE ALTDMNVRIS VDDFGTGYSS       660
     LAYLKRFPLH NLKVDRSFVS GVPDHHDSVA ITQAVVAMAH SLGMKVTAEG VETQAQSWFL       720
     QQIGCDMQQG YLFSRPLDAS DYARRLGAA                                         749
//

If you have problems or comments...

PBIL Back to PBIL home page