(data stored in ACNUC1104 zone)

EMBL: CP000959.PE284

CP000959.PE284       Location/Qualifiers
FT   CDS             complement(341456..342349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3472"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bte:BTH_II0243 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92625"
FT                   /db_xref="GOA:B1K2I0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2I0"
FT                   /protein_id="ACA92625.1"
FT                   /translation="MDDLNDLYYFVKVVEHGGFTQAGRALDVPKSTLSRRIAALEARYD
FT                   VRLLQRTTRHFTVTETGREFYERCLAVLVEADAAREVIERRHAEPRGIVRVSCPTALLE
FT                   FRVSELVARFMAIHPQVHVHLEATNRRVDLLSEGFDLALRVRFPPLEDSDLVMRVLADS
FT                   PQRLVAAPQWLDGRTAPSDPAELIGVPSLDWGPARHHVWQLVGPNGEHAQLRHHPRFVT
FT                   DDMHALRDAAIHGVGIVQLPCMVVEDDLRDGTLIDVLPGWAPKGGVVHAVFPSRRGLLP
FT                   RVRLLIDFLAEHIRKD"
     MDDLNDLYYF VKVVEHGGFT QAGRALDVPK STLSRRIAAL EARYDVRLLQ RTTRHFTVTE        60
     TGREFYERCL AVLVEADAAR EVIERRHAEP RGIVRVSCPT ALLEFRVSEL VARFMAIHPQ       120
     VHVHLEATNR RVDLLSEGFD LALRVRFPPL EDSDLVMRVL ADSPQRLVAA PQWLDGRTAP       180
     SDPAELIGVP SLDWGPARHH VWQLVGPNGE HAQLRHHPRF VTDDMHALRD AAIHGVGIVQ       240
     LPCMVVEDDL RDGTLIDVLP GWAPKGGVVH AVFPSRRGLL PRVRLLIDFL AEHIRKD          297
//

If you have problems or comments...

PBIL Back to PBIL home page