(data stored in ACNUC1104 zone)

EMBL: CP000959.PE289

CP000959.PE289       Location/Qualifiers
FT   CDS             346264..347583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3477"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B2032
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92630"
FT                   /db_xref="GOA:B1K2I5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2I5"
FT                   /protein_id="ACA92630.1"
FT                   /translation="MQTRSTLDEHATIATPAPERTAKHYLLAGWASMAGTTIEWYDFFL
FT                   YGTAAALVFNRIFFPSLDPVVGTLAAFGTFAVGFIGRPMGGIVFGHFGDRIGRKSMLMI
FT                   TLLLMGVPSMIIGLIPSYDSIGYWAAALLIAMRFLQGMAVGGEWGGAVLMAVEHAPKGR
FT                   KGLFGSLPQTGVGLGLILSSVAMAAVAALPEADMLSWGWRVPFLASIALVGLGWFIRAK
FT                   VPESPDFEKMQRQGKAEKSPVTAALRRHPREVLTIVGARAAENTWFYMVVTFALAYATQ
FT                   QLHLPKAEMLHAITAGAALSLVTMPLCGHLSDRIGQRRMFAIGLVLMCAFAAPFFMMLG
FT                   TQQTSTAWWAIVLGLGVVFPILYAPESLLFAQQFPAEIRYSGISLSVQLAGVIGGGFAP
FT                   MIATSLLKAGGGQPHYVIAYLVGFGVFALVCTALMRPARA"
     MQTRSTLDEH ATIATPAPER TAKHYLLAGW ASMAGTTIEW YDFFLYGTAA ALVFNRIFFP        60
     SLDPVVGTLA AFGTFAVGFI GRPMGGIVFG HFGDRIGRKS MLMITLLLMG VPSMIIGLIP       120
     SYDSIGYWAA ALLIAMRFLQ GMAVGGEWGG AVLMAVEHAP KGRKGLFGSL PQTGVGLGLI       180
     LSSVAMAAVA ALPEADMLSW GWRVPFLASI ALVGLGWFIR AKVPESPDFE KMQRQGKAEK       240
     SPVTAALRRH PREVLTIVGA RAAENTWFYM VVTFALAYAT QQLHLPKAEM LHAITAGAAL       300
     SLVTMPLCGH LSDRIGQRRM FAIGLVLMCA FAAPFFMMLG TQQTSTAWWA IVLGLGVVFP       360
     ILYAPESLLF AQQFPAEIRY SGISLSVQLA GVIGGGFAPM IATSLLKAGG GQPHYVIAYL       420
     VGFGVFALVC TALMRPARA                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page