(data stored in ACNUC1104 zone)

EMBL: CP000959.PE294

CP000959.PE294       Location/Qualifiers
FT   CDS             complement(353201..353704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3482"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bmu:Bmul_4546 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92635"
FT                   /db_xref="GOA:B1K2J0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2J0"
FT                   /protein_id="ACA92635.1"
FT                   /translation="MSHPASPSRPLAFRVNGTPHTFADAAPDAPLLLVLRNDCALNGPK
FT                   YGCGLGQCGACTVLVDGQATRSCVVPAAAAHGRDVTTLEGLGSCDAPHAIQRAFIDEQA
FT                   AQCGYCLNGMIMSTKALLDRNPAPDDAAIRDALRFNLCRCGTHLEIIRAVHRAARYLRG
FT                   GDEA"
     MSHPASPSRP LAFRVNGTPH TFADAAPDAP LLLVLRNDCA LNGPKYGCGL GQCGACTVLV        60
     DGQATRSCVV PAAAAHGRDV TTLEGLGSCD APHAIQRAFI DEQAAQCGYC LNGMIMSTKA       120
     LLDRNPAPDD AAIRDALRFN LCRCGTHLEI IRAVHRAARY LRGGDEA                     167
//

If you have problems or comments...

PBIL Back to PBIL home page