(data stored in ACNUC1104 zone)

EMBL: CP000959.PE298

CP000959.PE298       Location/Qualifiers
FT   CDS             357002..358042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_4550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92639"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2J4"
FT                   /protein_id="ACA92639.1"
FT                   /translation="MPVSDTQLIDAWKQVLTLSRLEPDQTVTILTSAATHPQTLSCALI
FT                   ATQSLGAIVNRLDLPPVNGDKAFSRDPLAYLGTTPLTGNKAAIAALRESDLVLDLMTLL
FT                   FSPEQHDILKSGTKILLAVEPPEVLVRMVPTLADRTRVLAAAKKIAAAREMRVSSAAGT
FT                   ALVCPLGEFPPTAEYGFVDAPGRWDHWPSGFALTYPNDRTARGTIVIDRGDILLPQKHY
FT                   VREPIALTVEGGYATRIEGGVDADLLRDYMETFADPEGYAISHIGWGLQPRARWSTLGL
FT                   YDREATIGMDARAFEGNFLFSLGPNNEGGGSRTTTCHIDIPLRRCTVELDGETVVREGR
FT                   VTDQPV"
     MPVSDTQLID AWKQVLTLSR LEPDQTVTIL TSAATHPQTL SCALIATQSL GAIVNRLDLP        60
     PVNGDKAFSR DPLAYLGTTP LTGNKAAIAA LRESDLVLDL MTLLFSPEQH DILKSGTKIL       120
     LAVEPPEVLV RMVPTLADRT RVLAAAKKIA AAREMRVSSA AGTALVCPLG EFPPTAEYGF       180
     VDAPGRWDHW PSGFALTYPN DRTARGTIVI DRGDILLPQK HYVREPIALT VEGGYATRIE       240
     GGVDADLLRD YMETFADPEG YAISHIGWGL QPRARWSTLG LYDREATIGM DARAFEGNFL       300
     FSLGPNNEGG GSRTTTCHID IPLRRCTVEL DGETVVREGR VTDQPV                      346
//

If you have problems or comments...

PBIL Back to PBIL home page