(data stored in ACNUC1104 zone)

EMBL: CP000959.PE30

CP000959.PE30        Location/Qualifiers
FT   CDS             complement(32881..33840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3215"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bur:Bcep18194_B1711 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92371"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1K891"
FT                   /protein_id="ACA92371.1"
FT                   /translation="MAKAFASQADLEEKKVTWTKLSENAYAYTAEGDPNSGVIIGDDSV
FT                   LIVDTTATPAMAQDLIAKIRSVTDKPIKHVVLSHYHAVRVLGASAYFDEGAQHVIASRG
FT                   TYEMIVERGEADMKSEIERFPRLFAGVETVPGLTWPTLVFEREITLFLGKLEVKIMHVG
FT                   SGHTKGDTIVWLPSQKVLFSGDLVEYDAACYCGDAQLEQWPATLEALRALGAEKLVPGR
FT                   GPALLNPAEVNKGLDYTKDFVTTLLAQGRKAVERNLDLKAAMALTREAMDPKFGHVFIY
FT                   EHCLPFDVSRAFDEASGIAHPRIWTAQRDKDMWAALQD"
     MAKAFASQAD LEEKKVTWTK LSENAYAYTA EGDPNSGVII GDDSVLIVDT TATPAMAQDL        60
     IAKIRSVTDK PIKHVVLSHY HAVRVLGASA YFDEGAQHVI ASRGTYEMIV ERGEADMKSE       120
     IERFPRLFAG VETVPGLTWP TLVFEREITL FLGKLEVKIM HVGSGHTKGD TIVWLPSQKV       180
     LFSGDLVEYD AACYCGDAQL EQWPATLEAL RALGAEKLVP GRGPALLNPA EVNKGLDYTK       240
     DFVTTLLAQG RKAVERNLDL KAAMALTREA MDPKFGHVFI YEHCLPFDVS RAFDEASGIA       300
     HPRIWTAQRD KDMWAALQD                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page