(data stored in ACNUC1104 zone)

EMBL: CP000959.PE301

CP000959.PE301       Location/Qualifiers
FT   CDS             complement(361249..361695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3489"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bmu:Bmul_4553
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92642"
FT                   /db_xref="GOA:B1K2J7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2J7"
FT                   /protein_id="ACA92642.1"
FT                   /translation="MASSKDSYDFHDQVGHLLRRAYQRHVSIFQEAIPDSDLTAAQFVT
FT                   LCAVKERQACSLNDIVKATAIDQATIRGVVERLKTRALIEVLPDPNDGRKLIVRATAAG
FT                   LALIDRTVPFARQVTERTYGALNPGERVALQFLLRKMMEEDGDA"
     MASSKDSYDF HDQVGHLLRR AYQRHVSIFQ EAIPDSDLTA AQFVTLCAVK ERQACSLNDI        60
     VKATAIDQAT IRGVVERLKT RALIEVLPDP NDGRKLIVRA TAAGLALIDR TVPFARQVTE       120
     RTYGALNPGE RVALQFLLRK MMEEDGDA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page