(data stored in ACNUC1104 zone)

EMBL: CP000959.PE303

CP000959.PE303       Location/Qualifiers
FT   CDS             363825..364586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92644"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2J9"
FT                   /protein_id="ACA92644.1"
FT                   /translation="MKSIRTIVALCSVISVLAACGGGDDAGTVLGISKPQARFINAVPA
FT                   GPNLDYYLNGKVDQSGVAYKGVTRYHDVDSGTQTASYDVSGTTTTIASQAFSASNGHHY
FT                   TTIALPSTTSLISVIDDPYDKGLLSDKARVRSFNASPNAQNVDVYVVPPGTDITTVSPT
FT                   MAGAAYQNAVPATTQDSVYLNGGTYQVVVTTAGSKSPILKTAPVSIGNNADWLVLTIPS
FT                   GGVGDVTPNDIHVLVAQGNDADTSAQELGPQ"
     MKSIRTIVAL CSVISVLAAC GGGDDAGTVL GISKPQARFI NAVPAGPNLD YYLNGKVDQS        60
     GVAYKGVTRY HDVDSGTQTA SYDVSGTTTT IASQAFSASN GHHYTTIALP STTSLISVID       120
     DPYDKGLLSD KARVRSFNAS PNAQNVDVYV VPPGTDITTV SPTMAGAAYQ NAVPATTQDS       180
     VYLNGGTYQV VVTTAGSKSP ILKTAPVSIG NNADWLVLTI PSGGVGDVTP NDIHVLVAQG       240
     NDADTSAQEL GPQ                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page