(data stored in ACNUC1104 zone)

EMBL: CP000959.PE305

CP000959.PE305       Location/Qualifiers
FT   CDS             365307..365654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_4557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92646"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K1"
FT                   /protein_id="ACA92646.1"
FT                   /translation="MRTAARTPSGARASGHRTSAANGALTHRPPRLSAVGQPPLAPLGA
FT                   EAAPGRLAPASAPLLGMPDGAVEGAVEGAADMPLAALESELAAPLSPFFWQPAPAARPA
FT                   IRMPAKTARDT"
     MRTAARTPSG ARASGHRTSA ANGALTHRPP RLSAVGQPPL APLGAEAAPG RLAPASAPLL        60
     GMPDGAVEGA VEGAADMPLA ALESELAAPL SPFFWQPAPA ARPAIRMPAK TARDT            115
//

If you have problems or comments...

PBIL Back to PBIL home page