(data stored in ACNUC1104 zone)

EMBL: CP000959.PE308

CP000959.PE308       Location/Qualifiers
FT   CDS             368266..369450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3496"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2041
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92649"
FT                   /db_xref="GOA:B1K2K4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K4"
FT                   /protein_id="ACA92649.1"
FT                   /translation="MRAPLDPTALPRCTSDATGALDVLDARLMRILLVLLTERTVSRAA
FT                   VRLNMSQPATSAALKRLRTLLGDPLLVRSRYGMVPTEFGARLIEPLRNALRVIDFIRIQ
FT                   QPTFDARTSVRTYRIGCPDYLNVLFVPKLVALFRERAPHAQLVFHPLGDGFDDERALAD
FT                   GDLDVVIDNRPVRQSRFRQDDLFDDRVVCLMRATHPLARRDAMTAAGFAVAPQLCPTPS
FT                   WLEASGAIDRQLERVGLQRRIVVTLPHFELAAHALVRTDLILTTTYRLARHYAKLLPLA
FT                   AVALPVEPPDIAYRMTWNESGSCAEGGRWLRVLIAEATRAWLDAEARLPAVAAVAAVAA
FT                   SGADADATNTAVVGTDPPEPTRRTRRRPATHCHASHPARVAQAARIHRGATKSH"
     MRAPLDPTAL PRCTSDATGA LDVLDARLMR ILLVLLTERT VSRAAVRLNM SQPATSAALK        60
     RLRTLLGDPL LVRSRYGMVP TEFGARLIEP LRNALRVIDF IRIQQPTFDA RTSVRTYRIG       120
     CPDYLNVLFV PKLVALFRER APHAQLVFHP LGDGFDDERA LADGDLDVVI DNRPVRQSRF       180
     RQDDLFDDRV VCLMRATHPL ARRDAMTAAG FAVAPQLCPT PSWLEASGAI DRQLERVGLQ       240
     RRIVVTLPHF ELAAHALVRT DLILTTTYRL ARHYAKLLPL AAVALPVEPP DIAYRMTWNE       300
     SGSCAEGGRW LRVLIAEATR AWLDAEARLP AVAAVAAVAA SGADADATNT AVVGTDPPEP       360
     TRRTRRRPAT HCHASHPARV AQAARIHRGA TKSH                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page