(data stored in ACNUC1104 zone)

EMBL: CP000959.PE309

CP000959.PE309       Location/Qualifiers
FT   CDS             369614..370045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92650"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K5"
FT                   /protein_id="ACA92650.1"
FT                   /translation="MKHTLIALAIPVALFASTGAFAGTQDCATRIRALHTQIDNAKRFG
FT                   NTQQAMRQQAALERIQANCTDAGQLARAERKLTDKARDVRHAEDEVRHAQARVHEAETL
FT                   GDARKLSNAQRKLADKQAKLRDATRDLHDAQVDRDALKG"
     MKHTLIALAI PVALFASTGA FAGTQDCATR IRALHTQIDN AKRFGNTQQA MRQQAALERI        60
     QANCTDAGQL ARAERKLTDK ARDVRHAEDE VRHAQARVHE AETLGDARKL SNAQRKLADK       120
     QAKLRDATRD LHDAQVDRDA LKG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page