(data stored in ACNUC1104 zone)

EMBL: CP000959.PE31

CP000959.PE31        Location/Qualifiers
FT   CDS             34019..35662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3216"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bur:Bcep18194_B1712 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92372"
FT                   /db_xref="GOA:B1K892"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K892"
FT                   /protein_id="ACA92372.1"
FT                   /translation="MQNHEVSADDAPPKAQRGIQSVEVGGRLLDALARRRKPLGLSELA
FT                   AAADLSTAQAHTYLVSLTRLALVKRDALTGNYEPGPLSLRLGLMSIERQPAYRATLPHA
FT                   VRLAETVGLSVALSVPGALGPTIVRIEHGGYPLHVNLHVGSVMSLDTTATGRVFRAFGD
FT                   AAQLAAMAASQAGAGATLAGAESPSVAPDAGAQPVELDAIRARGIERSIDRPSPGVSGM
FT                   CVPVLDAHGRLQLALTVIGSTGSIDVDWDGPIAAALRDAARQATASLGTEPAELAPAPG
FT                   VARVPPALADDAKTQRGINALDSTGDLLLALVSAGRALPLRDLATAAGMPAAKAFPHLV
FT                   SLQKIGLLSRDDAGCFDGGPLAQALGLIAMQRVSPTRDAEAEIVALAGATDMSVAAATL
FT                   GPLGPTVIRLEESARPQHVSLQVGTVMSLVNTAIGRIFASGMSDDVLADLLANEPVRLA
FT                   GAPPAPDDAAFRSRLATIRADELDFAFDAPVPGIGTIAAPVFDHTGSIRLVIAIIGSSR
FT                   GFPRGPDSELAQTLRAATRRLSWRFGWIGR"
     MQNHEVSADD APPKAQRGIQ SVEVGGRLLD ALARRRKPLG LSELAAAADL STAQAHTYLV        60
     SLTRLALVKR DALTGNYEPG PLSLRLGLMS IERQPAYRAT LPHAVRLAET VGLSVALSVP       120
     GALGPTIVRI EHGGYPLHVN LHVGSVMSLD TTATGRVFRA FGDAAQLAAM AASQAGAGAT       180
     LAGAESPSVA PDAGAQPVEL DAIRARGIER SIDRPSPGVS GMCVPVLDAH GRLQLALTVI       240
     GSTGSIDVDW DGPIAAALRD AARQATASLG TEPAELAPAP GVARVPPALA DDAKTQRGIN       300
     ALDSTGDLLL ALVSAGRALP LRDLATAAGM PAAKAFPHLV SLQKIGLLSR DDAGCFDGGP       360
     LAQALGLIAM QRVSPTRDAE AEIVALAGAT DMSVAAATLG PLGPTVIRLE ESARPQHVSL       420
     QVGTVMSLVN TAIGRIFASG MSDDVLADLL ANEPVRLAGA PPAPDDAAFR SRLATIRADE       480
     LDFAFDAPVP GIGTIAAPVF DHTGSIRLVI AIIGSSRGFP RGPDSELAQT LRAATRRLSW       540
     RFGWIGR                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page