(data stored in ACNUC1104 zone)

EMBL: CP000959.PE310

CP000959.PE310       Location/Qualifiers
FT   CDS             370272..371258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3498"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2045 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92651"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K6"
FT                   /protein_id="ACA92651.1"
FT                   /translation="MTHSSAPARRRALQRLAALAAAPLAGGLALPARAAGTDLSGVTLV
FT                   LGDQAGGLRALAEAAHVLDGAPYRFRWANFQGAAPLFEAQRAGAIDLAPAGDLPVLTAA
FT                   LGDPSLRIVATRVGSPASLGIVVQPDSPVRTVADLKGQTVVVSSARGSISQYQLYGALR
FT                   EHGLAPRDVDVRFVLPVDAFAAFEAKRIGIWATFDPYYGHAVRRGARIVRDGSGINSGL
FT                   AFLTSPVETLDDRGKRAALADVLARLARAGQWALAHPADYASVYASLTRLPPDAATDIA
FT                   RRAALAQRSLSGADIDVLQRVADRAAADAILPRRVDVASIAIRDVSA"
     MTHSSAPARR RALQRLAALA AAPLAGGLAL PARAAGTDLS GVTLVLGDQA GGLRALAEAA        60
     HVLDGAPYRF RWANFQGAAP LFEAQRAGAI DLAPAGDLPV LTAALGDPSL RIVATRVGSP       120
     ASLGIVVQPD SPVRTVADLK GQTVVVSSAR GSISQYQLYG ALREHGLAPR DVDVRFVLPV       180
     DAFAAFEAKR IGIWATFDPY YGHAVRRGAR IVRDGSGINS GLAFLTSPVE TLDDRGKRAA       240
     LADVLARLAR AGQWALAHPA DYASVYASLT RLPPDAATDI ARRAALAQRS LSGADIDVLQ       300
     RVADRAAADA ILPRRVDVAS IAIRDVSA                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page