(data stored in ACNUC1104 zone)

EMBL: CP000959.PE311

CP000959.PE311       Location/Qualifiers
FT   CDS             complement(371287..371661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92652"
FT                   /db_xref="InterPro:IPR019701"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K7"
FT                   /protein_id="ACA92652.1"
FT                   /translation="MQVQDLTGARLDYWVAIVEGHEAPRADASGCTSIRAAGGVPTPFA
FT                   PSSSWADGGPIVERLPFAAFEREGGRGAWRAVLHRAVPAAGERCTFNQAGPTLLVAAMR
FT                   TLVASTFGDDVPDLDMARPR"
     MQVQDLTGAR LDYWVAIVEG HEAPRADASG CTSIRAAGGV PTPFAPSSSW ADGGPIVERL        60
     PFAAFEREGG RGAWRAVLHR AVPAAGERCT FNQAGPTLLV AAMRTLVAST FGDDVPDLDM       120
     ARPR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page