(data stored in ACNUC1104 zone)

EMBL: CP000959.PE313

CP000959.PE313       Location/Qualifiers
FT   CDS             373069..374316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92654"
FT                   /db_xref="GOA:B1K2K9"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K9"
FT                   /protein_id="ACA92654.1"
FT                   /translation="MDISGSSIRREERPVRRWLTPGRIALYSAVMLVISVLLGAILLWV
FT                   GFHSTDSGTFRPGSGYMVFWSASHLMLHGSPWLAYDIPAFSRELATLFPVAGRHAFLPW
FT                   LYPPSYLLAVTPLALLPYAISYPVFVVLGIVLLGLAVWRVSGFGAVPGATRIGWLALFA
FT                   CPGVFVTAMYGQNAMLTTACAALAVYFVDRRPLLAGLCIGLLSVKPQMALLFPFVLIAA
FT                   RAWRAFAWAAAWATAITALGIAAGGMEPLRLFLQNAGALRSLIIEHGVPFWFASPTPFA
FT                   AFRLAGLSPALAYAGQAVIAAIALAAACFVWRRSRDARLRGAVLVVATLAANPYVWHYE
FT                   LSWLCIPIACMIAIGAQYGWRRGEQCVVAVMWALPMYEFLNPWLTLPQIGPAVTTTALL
FT                   VLLQRARTLPRSPARR"
     MDISGSSIRR EERPVRRWLT PGRIALYSAV MLVISVLLGA ILLWVGFHST DSGTFRPGSG        60
     YMVFWSASHL MLHGSPWLAY DIPAFSRELA TLFPVAGRHA FLPWLYPPSY LLAVTPLALL       120
     PYAISYPVFV VLGIVLLGLA VWRVSGFGAV PGATRIGWLA LFACPGVFVT AMYGQNAMLT       180
     TACAALAVYF VDRRPLLAGL CIGLLSVKPQ MALLFPFVLI AARAWRAFAW AAAWATAITA       240
     LGIAAGGMEP LRLFLQNAGA LRSLIIEHGV PFWFASPTPF AAFRLAGLSP ALAYAGQAVI       300
     AAIALAAACF VWRRSRDARL RGAVLVVATL AANPYVWHYE LSWLCIPIAC MIAIGAQYGW       360
     RRGEQCVVAV MWALPMYEFL NPWLTLPQIG PAVTTTALLV LLQRARTLPR SPARR            415
//

If you have problems or comments...

PBIL Back to PBIL home page