(data stored in ACNUC1104 zone)

EMBL: CP000959.PE314

CP000959.PE314       Location/Qualifiers
FT   CDS             374420..375487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3502"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2061 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92655"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2L0"
FT                   /protein_id="ACA92655.1"
FT                   /translation="MLPLRLLRSLLIASLFALPAAAAHADKPATIRIGVAQQGAGDPPT
FT                   FGGSSAATVQLQQLVEKEFAADGIKVEWLFFKGAGPAVNEAIANKALDFAYQGDLPAVL
FT                   ARSNGIKTRLLLAASVRSGIKIAVPPDSTIRSIKDLKDRRVSIFRGTNLQLVADNALAK
FT                   NGLGERDLRVINLDAASSLAALASKGIDASVGDYALYKLRDAGLAKIIYESQNDGPQLT
FT                   RQTHLLVLDDFDRAHPDIVQRVVTAFVKGAQWSSDEANRDALFKLWAKSGVPYSSWQAD
FT                   YANQRLKERLSPLIDPFVVARYKAVAQDALNLKLIRQPVDVDGWFEPKYLDNALRTLKL
FT                   ENYWPRYDAAGKPLT"
     MLPLRLLRSL LIASLFALPA AAAHADKPAT IRIGVAQQGA GDPPTFGGSS AATVQLQQLV        60
     EKEFAADGIK VEWLFFKGAG PAVNEAIANK ALDFAYQGDL PAVLARSNGI KTRLLLAASV       120
     RSGIKIAVPP DSTIRSIKDL KDRRVSIFRG TNLQLVADNA LAKNGLGERD LRVINLDAAS       180
     SLAALASKGI DASVGDYALY KLRDAGLAKI IYESQNDGPQ LTRQTHLLVL DDFDRAHPDI       240
     VQRVVTAFVK GAQWSSDEAN RDALFKLWAK SGVPYSSWQA DYANQRLKER LSPLIDPFVV       300
     ARYKAVAQDA LNLKLIRQPV DVDGWFEPKY LDNALRTLKL ENYWPRYDAA GKPLT            355
//

If you have problems or comments...

PBIL Back to PBIL home page