(data stored in ACNUC1104 zone)

EMBL: CP000959.PE320

CP000959.PE320       Location/Qualifiers
FT   CDS             complement(380341..382002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3508"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bur:Bcep18194_B2067 ABC peptide transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92661"
FT                   /db_xref="GOA:B1K2L6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2L6"
FT                   /protein_id="ACA92661.1"
FT                   /translation="MKNPFVSSAARQSRGVSPAGAALRCIAASLLLAGAATHAFAAPTG
FT                   KTLVYCTEGSPAGFDPGQHTTSTDFDASTYPVYNGLVQFKRGTLDLEPALATSWDVSPD
FT                   QRTITFHLRRGVKFQTTAWFKPTRPFQADDVVFTFRRMLDPDDPFRKAYPVSFPYFSDL
FT                   GFDHNIERIEKVDDYTVRFVLKSPDVVFVRNLAMAFASVLSAEYAGQLAARHRESDINQ
FT                   FPVGTGPFVLRTYQKDALIRYDANPDYWKPDDVKLSRLVFAITPDPAARLQKLVAGECQ
FT                   VSAFPRPADLETVRRDPKLTLFSGTGFNVGFVAYNTQHPPLDRVDVRRALDIAIDKTAI
FT                   IKTVFNGDATVATNPMPPAQWSYNPRLKDAPRDPAVAKALLAQAGFPNGFDLTLWAMPV
FT                   QRPYNPNAQLMAQLIQQDWAKIGVRAKIVSYEWGEYNRRAKHDGQHDAILYGWSGDNGD
FT                   PDNWLGTLLGCEAVHGSNLAKWCNKDFEQLVTAARSNGDVAKRTALYEQAQVVFKDQVP
FT                   FTPIATSIVSLPISRRVHGLTFSPLGGHRFDGVWLD"
     MKNPFVSSAA RQSRGVSPAG AALRCIAASL LLAGAATHAF AAPTGKTLVY CTEGSPAGFD        60
     PGQHTTSTDF DASTYPVYNG LVQFKRGTLD LEPALATSWD VSPDQRTITF HLRRGVKFQT       120
     TAWFKPTRPF QADDVVFTFR RMLDPDDPFR KAYPVSFPYF SDLGFDHNIE RIEKVDDYTV       180
     RFVLKSPDVV FVRNLAMAFA SVLSAEYAGQ LAARHRESDI NQFPVGTGPF VLRTYQKDAL       240
     IRYDANPDYW KPDDVKLSRL VFAITPDPAA RLQKLVAGEC QVSAFPRPAD LETVRRDPKL       300
     TLFSGTGFNV GFVAYNTQHP PLDRVDVRRA LDIAIDKTAI IKTVFNGDAT VATNPMPPAQ       360
     WSYNPRLKDA PRDPAVAKAL LAQAGFPNGF DLTLWAMPVQ RPYNPNAQLM AQLIQQDWAK       420
     IGVRAKIVSY EWGEYNRRAK HDGQHDAILY GWSGDNGDPD NWLGTLLGCE AVHGSNLAKW       480
     CNKDFEQLVT AARSNGDVAK RTALYEQAQV VFKDQVPFTP IATSIVSLPI SRRVHGLTFS       540
     PLGGHRFDGV WLD                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page