(data stored in ACNUC1104 zone)

EMBL: CP000959.PE324

CP000959.PE324       Location/Qualifiers
FT   CDS             384768..385676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3512"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2071
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92665"
FT                   /db_xref="GOA:B1K2M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M0"
FT                   /protein_id="ACA92665.1"
FT                   /translation="MDLLATMRIYVRVVERGTMSGAARDLDMGQPAVSERIEKLEKHLG
FT                   TRLLMRSARTLACTEEGRIFYERSKALLEAAELAVASVSKTAHALDGTIRLAAPQCFGE
FT                   VVLPGVLMQIRTAYPKLHIDLVLNDDIVDPVTEGVDISIRVGQLGDGGFVAYALGAVGR
FT                   VLVAAPSYLDRHGPLDTKADLANHPFIRVKGVFANEQVPLRHDGGAVEYARIRTVMTAS
FT                   HWRPMFDTIAAGGGIGVVQHPACTDALAHGRLVRLLPHYDVPDFALNVLVHAQRPLPPR
FT                   VRAVVDLLKSELPPLLTQGQR"
     MDLLATMRIY VRVVERGTMS GAARDLDMGQ PAVSERIEKL EKHLGTRLLM RSARTLACTE        60
     EGRIFYERSK ALLEAAELAV ASVSKTAHAL DGTIRLAAPQ CFGEVVLPGV LMQIRTAYPK       120
     LHIDLVLNDD IVDPVTEGVD ISIRVGQLGD GGFVAYALGA VGRVLVAAPS YLDRHGPLDT       180
     KADLANHPFI RVKGVFANEQ VPLRHDGGAV EYARIRTVMT ASHWRPMFDT IAAGGGIGVV       240
     QHPACTDALA HGRLVRLLPH YDVPDFALNV LVHAQRPLPP RVRAVVDLLK SELPPLLTQG       300
     QR                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page