(data stored in ACNUC1104 zone)

EMBL: CP000959.PE325

CP000959.PE325       Location/Qualifiers
FT   CDS             complement(385680..387065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3513"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   stm:STM0700 putrescine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92666"
FT                   /db_xref="GOA:B1K2M1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M1"
FT                   /protein_id="ACA92666.1"
FT                   /translation="MENTAHLSDAAPAAAQKHRMNVWQLTVLTAVNMMGSGIILLPSKL
FT                   AQVGTISLLSWIVTAGGSLALAYAFARCGMLSRKPGGMGGYAEYAFGKAGNYMANYTYG
FT                   LSLVIANVAIGVTAVGYGTVLFDATLSPLQTGLWTIFLLVLTTVANFGGSRITGRIGAV
FT                   TVWGVIIPVVVVSLIGWFWFSGATWGAAWNPHNLPFGPAVGSSIAVTLWAFLGLESACA
FT                   NSDAVENPERNVPIAVLGGTIASAIFYIVSTNVIAGIVPNAILAKSNAPFGIAFATMFT
FT                   PTVGTIVTALMVIACIGSLLGWQFTVAQVFKSSADVGYFLQVFARATRTGTPIVGMVIL
FT                   LVAQVALALMTISPELSSQFQKIVDLAVVTNLVPYVMSMAALITIQKVAKVPPGKALVT
FT                   NVIAMVATAYSFYALFSSGEQALMLGGLCVFLGWTLFGFVSARFYQMEVDAHVKEPGKS
FT                   LQA"
     MENTAHLSDA APAAAQKHRM NVWQLTVLTA VNMMGSGIIL LPSKLAQVGT ISLLSWIVTA        60
     GGSLALAYAF ARCGMLSRKP GGMGGYAEYA FGKAGNYMAN YTYGLSLVIA NVAIGVTAVG       120
     YGTVLFDATL SPLQTGLWTI FLLVLTTVAN FGGSRITGRI GAVTVWGVII PVVVVSLIGW       180
     FWFSGATWGA AWNPHNLPFG PAVGSSIAVT LWAFLGLESA CANSDAVENP ERNVPIAVLG       240
     GTIASAIFYI VSTNVIAGIV PNAILAKSNA PFGIAFATMF TPTVGTIVTA LMVIACIGSL       300
     LGWQFTVAQV FKSSADVGYF LQVFARATRT GTPIVGMVIL LVAQVALALM TISPELSSQF       360
     QKIVDLAVVT NLVPYVMSMA ALITIQKVAK VPPGKALVTN VIAMVATAYS FYALFSSGEQ       420
     ALMLGGLCVF LGWTLFGFVS ARFYQMEVDA HVKEPGKSLQ A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page