(data stored in ACNUC1104 zone)

EMBL: CP000959.PE326

CP000959.PE326       Location/Qualifiers
FT   CDS             complement(387131..389431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3514"
FT                   /product="response regulator receiver protein"
FT                   /EC_number="4.1.1.18"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bur:Bcep18194_B2074 response regulator receiver domain
FT                   protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92667"
FT                   /db_xref="GOA:B1K2M2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M2"
FT                   /protein_id="ACA92667.1"
FT                   /translation="MNTSIGGIRRLGMRALLVDDEIAQETATGRAVRTLSAELAQRGVD
FT                   VLTATSADDAIVLIRSDPSIQCVLLDWDLGVDGHGPSEAVVDAIRHRNGSVPIFLLADR
FT                   SVASSVPAAVMGKVDDFVWLLEDTADFIGGRIHAAIERYRSTVLPPMFGALAKFSRVYE
FT                   YSWHTPGHTGGTGFLKSPVGRAFFEYFGESLFRSDLSISVGELGSLLDHSGPIGESERY
FT                   AARVFGAHRTYHVTNGSSTSNRIILMTSVSRDQIALCDRNCHKSAEHAMTMSGAIPTYL
FT                   VPTRNRYGIIGPIAPERLTQVAIREAIASNPLAAGLADRQPKHAIVTNSTYDGLCYNVT
FT                   RVEELLGASVDRLHFDEAWYGYARFNPIYRDRHAMHGDPRDHHKDRPTVFATQSTHKLL
FT                   TALSQASYIHVRDGRSPIPHGQFNETFMMHASTSPNYAIIASNDVAAAMMDGPGGAALT
FT                   RESIEEAVAFRQMIARMNGEFGAKGDWFFECWQPDTVLDARTGRTLPFHEAPPELLASD
FT                   PACWVLRPGAQWHGFGNLEDGYCMLDPIKVSIVTPGVAPAGGLMPVGIPASVVTAYLDA
FT                   RGIVVEKTTDFTILFLFSIGITKGKWGSLVSALCDFKRDYDANLPLDMAIPSLAKEHGA
FT                   RYAGMGLKDLADTMFAAMEQLGTTRLMSEAFSILPKPEMSPVRAYEHLVQGRVEQVTLD
FT                   ELAGRTVATGVVPYPPGIPLLMPGENAGPAGGPVLGYLKALEAYDRRFPGFAHDTHGVE
FT                   VEDGTYRVYCLTA"
     MNTSIGGIRR LGMRALLVDD EIAQETATGR AVRTLSAELA QRGVDVLTAT SADDAIVLIR        60
     SDPSIQCVLL DWDLGVDGHG PSEAVVDAIR HRNGSVPIFL LADRSVASSV PAAVMGKVDD       120
     FVWLLEDTAD FIGGRIHAAI ERYRSTVLPP MFGALAKFSR VYEYSWHTPG HTGGTGFLKS       180
     PVGRAFFEYF GESLFRSDLS ISVGELGSLL DHSGPIGESE RYAARVFGAH RTYHVTNGSS       240
     TSNRIILMTS VSRDQIALCD RNCHKSAEHA MTMSGAIPTY LVPTRNRYGI IGPIAPERLT       300
     QVAIREAIAS NPLAAGLADR QPKHAIVTNS TYDGLCYNVT RVEELLGASV DRLHFDEAWY       360
     GYARFNPIYR DRHAMHGDPR DHHKDRPTVF ATQSTHKLLT ALSQASYIHV RDGRSPIPHG       420
     QFNETFMMHA STSPNYAIIA SNDVAAAMMD GPGGAALTRE SIEEAVAFRQ MIARMNGEFG       480
     AKGDWFFECW QPDTVLDART GRTLPFHEAP PELLASDPAC WVLRPGAQWH GFGNLEDGYC       540
     MLDPIKVSIV TPGVAPAGGL MPVGIPASVV TAYLDARGIV VEKTTDFTIL FLFSIGITKG       600
     KWGSLVSALC DFKRDYDANL PLDMAIPSLA KEHGARYAGM GLKDLADTMF AAMEQLGTTR       660
     LMSEAFSILP KPEMSPVRAY EHLVQGRVEQ VTLDELAGRT VATGVVPYPP GIPLLMPGEN       720
     AGPAGGPVLG YLKALEAYDR RFPGFAHDTH GVEVEDGTYR VYCLTA                      766
//

If you have problems or comments...

PBIL Back to PBIL home page