(data stored in ACNUC1104 zone)

EMBL: CP000959.PE327

CP000959.PE327       Location/Qualifiers
FT   CDS             389940..392120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3515"
FT                   /product="Ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bur:Bcep18194_B2075 ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92668"
FT                   /db_xref="GOA:B1K2M3"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M3"
FT                   /protein_id="ACA92668.1"
FT                   /translation="MSLLKIAVEPALIGAFLTTHEQVDVFQTDFTNIAAIVVGIDAAEK
FT                   VLKTVERTGFAIPFFVAVEPDQEVPPSVLPRASGVIQLRHGGRHYYGRQISAAADIYSE
FT                   NLLPPFFKVMRDYVQRGYVEFDCPGHQGGQFFSNHPLGRMFFDFFGETLFRADLCNADV
FT                   RLGDLLIHEGPALEAQRNAARIYNADKTWFVLNGTSTSNKVVTSALLAPDDLVLFDRNN
FT                   HKSVHLGALVLSGARPVYLETARNAWGLIGGVDSAALGEARIRDAIRDVAPERADLPRP
FT                   FRLAVIQLGTYDGTIYNAREIVDRIGHLCDYILFDSAWVGYEQFIPMMQDCSPLMLTLG
FT                   PDDPGIFVTQSVHKQQAGFSQTSQIHKKDRHIEGQKRFCDHRRFNNAYMIHASTSPFYP
FT                   MFAALDVNAQMHAGPAGRRLWRDCVAHGVDARKLLLKTCRQIRPFVPQEIDGRPWADYP
FT                   TEQIVDDLRFFRFHPADTWHGFEGYADDQYFVDPCKLLLTTPGIDRDTHEYAPFGAPAP
FT                   ILARYLREHGVVPEKADLYTILFLLTPSESFGKLQHLVAHLAQFERHLDQDTPLREAIP
FT                   SLCEAYPELYGTMRLRQLCQRMHDFYRSHDMKHLQKQMFRRAQFPKQAMLPQAANAELI
FT                   RNNVELVTLERIEGRIATEGALPYPPGIFCVVPGEAWGGPALDYFRALEAGINALPGFE
FT                   PEIQGVYLQTKPDGTKQASAYVVAAGADASRM"
     MSLLKIAVEP ALIGAFLTTH EQVDVFQTDF TNIAAIVVGI DAAEKVLKTV ERTGFAIPFF        60
     VAVEPDQEVP PSVLPRASGV IQLRHGGRHY YGRQISAAAD IYSENLLPPF FKVMRDYVQR       120
     GYVEFDCPGH QGGQFFSNHP LGRMFFDFFG ETLFRADLCN ADVRLGDLLI HEGPALEAQR       180
     NAARIYNADK TWFVLNGTST SNKVVTSALL APDDLVLFDR NNHKSVHLGA LVLSGARPVY       240
     LETARNAWGL IGGVDSAALG EARIRDAIRD VAPERADLPR PFRLAVIQLG TYDGTIYNAR       300
     EIVDRIGHLC DYILFDSAWV GYEQFIPMMQ DCSPLMLTLG PDDPGIFVTQ SVHKQQAGFS       360
     QTSQIHKKDR HIEGQKRFCD HRRFNNAYMI HASTSPFYPM FAALDVNAQM HAGPAGRRLW       420
     RDCVAHGVDA RKLLLKTCRQ IRPFVPQEID GRPWADYPTE QIVDDLRFFR FHPADTWHGF       480
     EGYADDQYFV DPCKLLLTTP GIDRDTHEYA PFGAPAPILA RYLREHGVVP EKADLYTILF       540
     LLTPSESFGK LQHLVAHLAQ FERHLDQDTP LREAIPSLCE AYPELYGTMR LRQLCQRMHD       600
     FYRSHDMKHL QKQMFRRAQF PKQAMLPQAA NAELIRNNVE LVTLERIEGR IATEGALPYP       660
     PGIFCVVPGE AWGGPALDYF RALEAGINAL PGFEPEIQGV YLQTKPDGTK QASAYVVAAG       720
     ADASRM                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page