(data stored in ACNUC1104 zone)

EMBL: CP000959.PE33

CP000959.PE33        Location/Qualifiers
FT   CDS             37246..37899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3218"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bam:Bamb_3717 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92374"
FT                   /db_xref="GOA:B1K894"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B1K894"
FT                   /protein_id="ACA92374.1"
FT                   /translation="MSFKLYLSFLAASVVLIYAPGPVNLLTMNQALRTGWRRALPCVWG
FT                   GTLAVLLQLALTALCLNSLVHLDEHALTVLRWAGAAYLVWLGGKQWLSRTPAGAAAAPA
FT                   ETDAGTAIATPDTDGRALFWRGVATSGLNPKTLLFFPSFFPQFISPNADWSLNLQYLLL
FT                   AATFALLFAGGVASMALFSHRLSRALQRPARMRAMNRVTGGLLVGMGAIMVGWN"
     MSFKLYLSFL AASVVLIYAP GPVNLLTMNQ ALRTGWRRAL PCVWGGTLAV LLQLALTALC        60
     LNSLVHLDEH ALTVLRWAGA AYLVWLGGKQ WLSRTPAGAA AAPAETDAGT AIATPDTDGR       120
     ALFWRGVATS GLNPKTLLFF PSFFPQFISP NADWSLNLQY LLLAATFALL FAGGVASMAL       180
     FSHRLSRALQ RPARMRAMNR VTGGLLVGMG AIMVGWN                                217
//

If you have problems or comments...

PBIL Back to PBIL home page