(data stored in ACNUC1104 zone)

EMBL: CP000959.PE332

CP000959.PE332       Location/Qualifiers
FT   CDS             396126..397085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3520"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2085
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92673"
FT                   /db_xref="GOA:B1K2M8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M8"
FT                   /protein_id="ACA92673.1"
FT                   /translation="MEDIDLNLVTALDVLLSEASVTGAARRLGLSTSAMSRTLTRLRTA
FT                   TGDQLLVRAGRKLVPTPHAAALRDRVHAVASDARAVLRPATADVDLATLTATFTIRAAA
FT                   SFMEMLSGPVVAALGDVAPRVRIRFVPKLDRDPQALRDGTVDLEIGKRGDDAPELHTRM
FT                   LFHDWHVAVARAGHPLFASARITPARYAACRHVMAVQLGDFGGLADDSTANTGDGPAVH
FT                   VVVPGYPDAMRVAASTDLIALVPRSSLGNACSQGLTEALGLRSFEIPVRLPAILVSALW
FT                   HPRMHGDPVHRRLRDTVIAVCQRAYPDARPPRAAARGK"
     MEDIDLNLVT ALDVLLSEAS VTGAARRLGL STSAMSRTLT RLRTATGDQL LVRAGRKLVP        60
     TPHAAALRDR VHAVASDARA VLRPATADVD LATLTATFTI RAAASFMEML SGPVVAALGD       120
     VAPRVRIRFV PKLDRDPQAL RDGTVDLEIG KRGDDAPELH TRMLFHDWHV AVARAGHPLF       180
     ASARITPARY AACRHVMAVQ LGDFGGLADD STANTGDGPA VHVVVPGYPD AMRVAASTDL       240
     IALVPRSSLG NACSQGLTEA LGLRSFEIPV RLPAILVSAL WHPRMHGDPV HRRLRDTVIA       300
     VCQRAYPDAR PPRAAARGK                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page