(data stored in ACNUC1104 zone)

EMBL: CP000959.PE340

CP000959.PE340       Location/Qualifiers
FT   CDS             complement(401578..402918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3528"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bvi:Bcep1808_1626 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92681"
FT                   /db_xref="GOA:B1K2N6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2N6"
FT                   /protein_id="ACA92681.1"
FT                   /translation="MQASSSHEPARLKRTLGLPSVLLFGLAYMAPLIVYGTYGVLAKAS
FT                   DDTAALAYLLALVAIAFTALSYGKLARLYPAAGSAYTYTRRTFNPHLGFMIGWATLLDY
FT                   FFLPMVIWLIGAAYLNAAFPHVPTWIWIVAFIVLTSGLNIVGIELAARFNIVLMVVQLA
FT                   IVAMFVVLCWHYASAAAGPGGIAMAEPFFKPHVPFGATMAGAAIAAYSYLGFDAVSTLT
FT                   EETIDPKKNMPRAILLIALIGGAIFVIAAYTMQLAHPGVDFKDTDSAAFEVAKMIGGDL
FT                   FVTVFLAGLILAQFASGISAQASVGRLLYAMGRDEILPKRIFGFIHPRFKTPAINIALA
FT                   GVVGLIALKLDVATSTSFINFGAFLAFTAVNLCVIRLYLSGNHGERRIGVFGGLVFPAI
FT                   GAVSDIWLLVSLEKAALVLGVVWFALGLVYLCWITRLFRQAPPEVAI"
     MQASSSHEPA RLKRTLGLPS VLLFGLAYMA PLIVYGTYGV LAKASDDTAA LAYLLALVAI        60
     AFTALSYGKL ARLYPAAGSA YTYTRRTFNP HLGFMIGWAT LLDYFFLPMV IWLIGAAYLN       120
     AAFPHVPTWI WIVAFIVLTS GLNIVGIELA ARFNIVLMVV QLAIVAMFVV LCWHYASAAA       180
     GPGGIAMAEP FFKPHVPFGA TMAGAAIAAY SYLGFDAVST LTEETIDPKK NMPRAILLIA       240
     LIGGAIFVIA AYTMQLAHPG VDFKDTDSAA FEVAKMIGGD LFVTVFLAGL ILAQFASGIS       300
     AQASVGRLLY AMGRDEILPK RIFGFIHPRF KTPAINIALA GVVGLIALKL DVATSTSFIN       360
     FGAFLAFTAV NLCVIRLYLS GNHGERRIGV FGGLVFPAIG AVSDIWLLVS LEKAALVLGV       420
     VWFALGLVYL CWITRLFRQA PPEVAI                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page