(data stored in ACNUC1104 zone)

EMBL: CP000959.PE345

CP000959.PE345       Location/Qualifiers
FT   CDS             complement(407084..407992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3534"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B2608 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92686"
FT                   /db_xref="GOA:B1K332"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:B1K332"
FT                   /protein_id="ACA92686.1"
FT                   /translation="MELRQLRYFLAVADEGQFTRAAARLHIQQPPLSQQIQELEHELGF
FT                   ALFVRQPRGAVLTAPGEIFAARARTVLLELNNAVVHARRVAQGRIGTVRVALTSSAAFH
FT                   PLTPTAIRNFRDMYPGISIEMSEVNAAEIIEMMLNGRADAAILRKPVETSADLRFELLA
FT                   EERMLLVLPVGHRLIGGRSVSLKQLANESFIFVRRPGAPGMYADFIRACQAKGFEPHVV
FT                   EEVPRMVTAINLVAAGGGVSLVPASMQRYRQESVRYCRVAGDHAFRAPLHLVTRHDLQN
FT                   PAASHFREALLMFVQHHPYRE"
     MELRQLRYFL AVADEGQFTR AAARLHIQQP PLSQQIQELE HELGFALFVR QPRGAVLTAP        60
     GEIFAARART VLLELNNAVV HARRVAQGRI GTVRVALTSS AAFHPLTPTA IRNFRDMYPG       120
     ISIEMSEVNA AEIIEMMLNG RADAAILRKP VETSADLRFE LLAEERMLLV LPVGHRLIGG       180
     RSVSLKQLAN ESFIFVRRPG APGMYADFIR ACQAKGFEPH VVEEVPRMVT AINLVAAGGG       240
     VSLVPASMQR YRQESVRYCR VAGDHAFRAP LHLVTRHDLQ NPAASHFREA LLMFVQHHPY       300
     RE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page